Project name: query_structure

Status: done

Started: 2026-03-16 22:55:30
Settings
Chain sequence(s) A: AGGERVYLPNLNADQLCAFIRSLEDDPSQSANLLAEAKKLNDAQAPASSSSGSSSSGRASAGGERVYLPNLNADQLCAFIRSLEDDPSQSANLLAEAKKLNDAQAPK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:12)
Show buried residues

Minimal score value
-4.2081
Maximal score value
0.39
Average score
-1.6065
Total score value
-171.8959

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -0.5466
2 G A -1.4477
3 G A -2.3435
4 E A -2.8078
5 R A -2.6945
6 V A -0.7415
7 Y A 0.3900
8 L A 0.0000
9 P A -0.1665
10 N A -0.8178
11 L A 0.0000
12 N A -1.1974
13 A A -1.2816
14 D A -2.0041
15 Q A -1.1601
16 L A 0.0000
17 C A -1.2995
18 A A -1.0419
19 F A -1.0061
20 I A -1.8917
21 R A -3.0757
22 S A -2.6077
23 L A -2.7273
24 E A -3.9865
25 D A -4.2081
26 D A -3.8968
27 P A -2.7845
28 S A -1.8976
29 Q A -2.2970
30 S A -1.6812
31 A A -0.9213
32 N A -1.6785
33 L A -1.3958
34 L A -1.0358
35 A A -1.5146
36 E A -2.2344
37 A A 0.0000
38 K A -2.2746
39 K A -2.9800
40 L A -1.7673
41 N A 0.0000
42 D A -2.8021
43 A A -1.5309
44 Q A -1.3062
45 A A -1.1362
46 P A -0.6630
47 A A -0.6187
48 S A -0.4300
49 S A -0.4825
50 S A -0.5580
51 S A -0.6577
52 G A -0.7633
53 S A -0.6454
54 S A -0.5770
55 S A -0.5805
56 S A -1.0056
57 G A -1.5942
58 R A -2.1701
59 A A -1.1970
60 S A -1.2836
61 A A -0.8506
62 G A -1.3826
63 G A -2.0709
64 E A -2.6898
65 R A -2.4418
66 V A -0.8017
67 Y A 0.3625
68 L A 0.0000
69 P A -0.0093
70 N A -0.8548
71 L A 0.0000
72 N A -1.4685
73 A A -1.3195
74 D A -2.0739
75 Q A -1.2427
76 L A -0.9268
77 C A -1.3219
78 A A -1.1715
79 F A 0.0000
80 I A -1.9796
81 R A -3.2385
82 S A -2.5979
83 L A -2.7920
84 E A -4.1403
85 D A -4.1967
86 D A -3.8639
87 P A -2.7800
88 S A -1.9295
89 Q A -2.3803
90 S A -1.8731
91 A A -1.0137
92 N A -1.8083
93 L A -1.6541
94 L A -1.4029
95 A A -1.8484
96 E A -2.7914
97 A A 0.0000
98 K A -2.7691
99 K A -3.3310
100 L A -2.0598
101 N A -2.1546
102 D A -3.2317
103 A A -1.8855
104 Q A -1.7238
105 A A -1.6406
106 P A -1.4519
107 K A -2.0685
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018