Project name: 883fda7d13222c9

Status: done

Started: 2026-07-01 15:24:10
Settings
Chain sequence(s) B: GQWTALSISVEDHPDGTGTLTVTLRQSQVAPVTLMWQDVETGEKRRAATV
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:24)
Show buried residues

Minimal score value
-4.2403
Maximal score value
2.6037
Average score
-0.9654
Total score value
-48.2695

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B -0.9161
2 Q B -1.7438
3 W B -0.7216
4 T B -0.7613
5 A B 0.2254
6 L B 0.7910
7 S B 1.0071
8 I B 2.6037
9 S B 1.2288
10 V B 0.7916
11 E B -2.1622
12 D B -3.2349
13 H B -2.9629
14 P B -2.3315
15 D B -2.7706
16 G B -2.1201
17 T B -2.1224
18 G B -2.0875
19 T B -0.8101
20 L B 0.7622
21 T B 1.0353
22 V B 1.4542
23 T B 0.4271
24 L B -0.2508
25 R B -2.2938
26 Q B -2.0027
27 S B -1.7555
28 Q B -1.4349
29 V B 0.9432
30 A B 0.2668
31 P B 0.4711
32 V B 0.8008
33 T B 0.3583
34 L B 0.1500
35 M B -1.0520
36 W B -1.4672
37 Q B -3.1803
38 D B -2.8048
39 V B -0.7054
40 E B -1.9147
41 T B -1.9597
42 G B -2.5013
43 E B -3.8675
44 K B -4.2403
45 R B -4.1104
46 R B -2.8706
47 A B -1.0668
48 A B 0.0479
49 T B 0.6796
50 V B 1.9101
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018