Project name: query_structure

Status: done

Started: 2026-03-16 20:30:50
Settings
Chain sequence(s) A: LPAPKNLVVSRVTEDSARLSWASWLVAFFDSFLIQYQESEKVGEAIVLIVPGSERSYDLTGLKPGTEYTVSIYGVYQRHASAFVSNPLSAIFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:51)
Show buried residues

Minimal score value
-2.9039
Maximal score value
2.778
Average score
-0.3397
Total score value
-31.9326

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 1.1599
2 P A 0.1542
3 A A -0.4330
4 P A 0.0000
5 K A -1.8458
6 N A -1.5529
7 L A -0.1789
8 V A 1.2341
9 V A 0.7119
10 S A -0.5990
11 R A -1.8310
12 V A -0.9595
13 T A -1.7138
14 E A -2.7797
15 D A -2.5501
16 S A -2.0235
17 A A 0.0000
18 R A -1.2694
19 L A 0.0000
20 S A -0.4021
21 W A 0.0000
22 A A -0.3587
23 S A 0.5835
24 W A 1.8321
25 L A 2.7780
26 V A 2.5023
27 A A 1.1297
28 F A 1.1688
29 F A 0.0000
30 D A -2.1740
31 S A -0.4624
32 F A 0.0000
33 L A 1.6934
34 I A 0.0000
35 Q A 1.0207
36 Y A 0.5242
37 Q A -0.5749
38 E A 0.0000
39 S A -1.3455
40 E A -2.3982
41 K A -1.6671
42 V A 0.1198
43 G A -0.8427
44 E A -1.6051
45 A A -0.1106
46 I A 1.1037
47 V A 2.4555
48 L A 2.3365
49 I A 2.5485
50 V A 0.0000
51 P A -0.6494
52 G A 0.0000
53 S A -0.7724
54 E A -1.3043
55 R A -0.7071
56 S A -0.6742
57 Y A -0.8291
58 D A -1.9270
59 L A 0.0000
60 T A -1.4488
61 G A -1.4358
62 L A 0.0000
63 K A -2.9039
64 P A -2.5635
65 G A -1.8881
66 T A -2.2172
67 E A -1.9634
68 Y A 0.0000
69 T A 0.0653
70 V A 0.0000
71 S A 0.2607
72 I A 0.0000
73 Y A 0.7785
74 G A 0.0000
75 V A 0.6024
76 Y A -0.2387
77 Q A -2.0294
78 R A -2.7034
79 H A -2.0877
80 A A -1.1327
81 S A -0.9666
82 A A -0.3060
83 F A 1.2946
84 V A 2.0422
85 S A 0.0000
86 N A -0.7231
87 P A -0.5285
88 L A -0.6680
89 S A 0.0715
90 A A 1.1987
91 I A 1.8190
92 F A 0.0000
93 T A -0.8524
94 T A -1.9237
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018