Project name: 88c2192316ec96f

Status: done

Started: 2026-06-23 11:00:46
Settings
Chain sequence(s) A: MSHHHHHHSGMEKVSKEEGEKAITDKSMPLHERLTIIARYLGFEAEQEQVGSHYAVWIKEEDFEEFFEKLPEELKKLLEDPSSGIEVFRVGDMVVIDIDPRYEKLFNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:14)
Show buried residues

Minimal score value
-4.2471
Maximal score value
0.6371
Average score
-1.3674
Total score value
-147.6777

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5500
2 S A -0.6214
3 H A -1.7375
4 H A -2.3383
5 H A -2.7648
6 H A -2.7484
7 H A -2.5021
8 H A -2.2455
9 S A -1.9377
10 G A -1.7499
11 M A -1.5186
12 E A -2.6760
13 K A -2.7106
14 V A -2.2264
15 S A -2.9034
16 K A -3.8030
17 E A -4.2471
18 E A -3.8734
19 G A 0.0000
20 E A -3.5958
21 K A -3.5031
22 A A 0.0000
23 I A -0.9429
24 T A -1.2730
25 D A -1.9923
26 K A -2.2337
27 S A -1.5204
28 M A -1.1298
29 P A -1.0436
30 L A 0.0000
31 H A 0.0000
32 E A -1.2107
33 R A 0.0000
34 L A 0.0000
35 T A 0.0000
36 I A -1.0945
37 I A 0.0000
38 A A 0.0000
39 R A -0.9914
40 Y A -1.2357
41 L A -0.4178
42 G A -0.6572
43 F A 0.0000
44 E A -1.8158
45 A A 0.0000
46 E A -2.0210
47 Q A -1.8155
48 E A -2.2827
49 Q A -1.7618
50 V A -0.5812
51 G A -0.7089
52 S A -0.8066
53 H A -1.0170
54 Y A -0.9692
55 A A 0.0000
56 V A 0.0000
57 W A -0.5720
58 I A 0.0000
59 K A -2.7018
60 E A -3.2229
61 E A -3.5724
62 D A -3.0177
63 F A 0.0000
64 E A -3.9714
65 E A -3.9758
66 F A 0.0000
67 F A -2.5684
68 E A -3.7219
69 K A -3.0243
70 L A 0.0000
71 P A -1.9027
72 E A -3.1835
73 E A -2.4684
74 L A 0.0000
75 K A -3.0158
76 K A -3.3815
77 L A 0.0000
78 L A 0.0000
79 E A -2.9832
80 D A -2.2225
81 P A -1.5415
82 S A -0.8573
83 S A 0.0000
84 G A -0.9779
85 I A 0.0000
86 E A -1.8882
87 V A -0.7097
88 F A 0.1903
89 R A -1.0447
90 V A 0.2661
91 G A -1.0793
92 D A -2.5740
93 M A -1.3955
94 V A 0.0000
95 V A 0.0000
96 I A 0.0000
97 D A -0.8672
98 I A 0.0000
99 D A 0.0000
100 P A -1.1179
101 R A -1.8969
102 Y A -0.4851
103 E A -1.0191
104 K A -1.4228
105 L A 0.6371
106 F A 0.1585
107 N A -1.2459
108 S A -0.6248
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018