Project name: query_structure

Status: done

Started: 2026-03-17 01:11:21
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDYYVITYGETGYYAYFQEFEVPGSKSTATISGLKPGVDYTITVYAAGYGYYYGNPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:32)
Show buried residues

Minimal score value
-3.6222
Maximal score value
2.1719
Average score
-0.452
Total score value
-41.1334

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7292
2 S A 0.2388
3 D A -0.2379
4 V A -0.5858
5 P A 0.0000
6 R A -3.5996
7 D A -3.6222
8 L A 0.0000
9 E A -2.1465
10 V A 0.1461
11 V A 1.5653
12 A A 0.9197
13 A A 0.3400
14 T A -0.3315
15 P A -1.1054
16 T A -0.9929
17 S A -0.5204
18 L A 0.0000
19 L A 0.7920
20 I A 0.0000
21 S A -1.1901
22 W A 0.0000
23 D A -3.3979
24 A A -1.7542
25 P A -0.4878
26 A A 0.4281
27 V A 0.5177
28 T A -0.0952
29 V A -0.4691
30 D A -1.4808
31 Y A -1.1239
32 Y A 0.0000
33 V A 0.0000
34 I A 0.0000
35 T A 0.0000
36 Y A -0.2820
37 G A 0.0000
38 E A -0.3547
39 T A -0.1834
40 G A 0.4296
41 Y A 1.8937
42 Y A 2.1719
43 A A 1.5977
44 Y A 1.6875
45 F A 0.6636
46 Q A -1.0345
47 E A -2.0907
48 F A -1.3439
49 E A -1.8566
50 V A 0.0000
51 P A -1.5297
52 G A -1.5703
53 S A -1.3893
54 K A -2.2119
55 S A -1.4100
56 T A -0.7535
57 A A 0.0000
58 T A 0.2536
59 I A 0.0000
60 S A -0.6530
61 G A -1.0265
62 L A 0.0000
63 K A -2.3610
64 P A -1.6676
65 G A -1.4614
66 V A -1.4181
67 D A -1.9008
68 Y A 0.0000
69 T A -0.5274
70 I A 0.0000
71 T A 0.0000
72 V A 0.0000
73 Y A 0.0909
74 A A 0.0000
75 A A 0.0000
76 G A 0.0000
77 Y A 1.2924
78 G A 0.7108
79 Y A 1.5820
80 Y A 1.4612
81 Y A 0.5554
82 G A -0.6382
83 N A -1.2596
84 P A -0.6575
85 I A -0.6415
86 S A -0.8342
87 I A -0.7042
88 N A -1.6960
89 Y A -1.4466
90 R A -2.5195
91 T A -1.6358
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018