Project name: 891c372cf63e8d6

Status: done

Started: 2026-07-09 04:26:56
Settings
Chain sequence(s) A: YPNVDLSNMGCEECTLKKNNVFSRDRPIYQCMGCCFSRAFPTPLKAMKTMTIPKNITSEATCCVAKHSYETEVAGIRVRNHTDCHCSTCYFHKI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:06)
Show buried residues

Minimal score value
-2.9683
Maximal score value
1.9831
Average score
-0.6938
Total score value
-65.2196

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Y A 0.9526
2 P A -0.3114
3 N A -1.0402
4 V A -0.3710
5 D A -1.4094
6 L A 0.5060
7 S A -0.2322
8 N A -0.7706
9 M A 0.3922
10 G A -0.3995
11 C A -0.5364
12 E A -2.2708
13 E A -2.3886
14 C A -1.0476
15 T A -0.9873
16 L A -0.6438
17 K A -1.4400
18 K A -2.0609
19 N A -1.3116
20 N A -1.2894
21 V A 0.7450
22 F A -0.3039
23 S A -1.6419
24 R A -2.7841
25 D A -2.9683
26 R A -2.0760
27 P A -1.7073
28 I A 0.0000
29 Y A -1.2552
30 Q A -1.2861
31 C A 0.0000
32 M A -0.4705
33 G A -0.9434
34 C A -0.1916
35 C A 0.8588
36 F A 1.4367
37 S A -0.5816
38 R A -2.0364
39 A A -0.8884
40 F A -0.0984
41 P A 0.1827
42 T A 0.0000
43 P A -0.1938
44 L A 0.1351
45 K A -1.4105
46 A A -1.0692
47 M A -0.6634
48 K A -1.5071
49 T A -0.6024
50 M A -0.0617
51 T A 0.5539
52 I A 1.3869
53 P A -0.1673
54 K A -1.3498
55 N A -1.1291
56 I A 0.4937
57 T A -0.5872
58 S A -1.1726
59 E A -2.1720
60 A A -0.8282
61 T A 0.3596
62 C A 1.1241
63 C A 0.3677
64 V A -0.1831
65 A A -1.3871
66 K A -2.3899
67 H A -2.1866
68 S A -1.5387
69 Y A -0.7140
70 E A -2.7784
71 T A -2.2758
72 E A -2.6650
73 V A 0.0000
74 A A -0.7486
75 G A -0.5880
76 I A 0.0500
77 R A -2.3082
78 V A -1.6991
79 R A -2.4633
80 N A 0.0000
81 H A -1.5892
82 T A -1.1808
83 D A -1.9459
84 C A -1.3193
85 H A -0.8336
86 C A 0.2894
87 S A 0.3463
88 T A 0.2891
89 C A 1.1355
90 Y A 1.8807
91 F A 1.9831
92 H A 0.3142
93 K A -0.3877
94 I A 0.8375
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018