Project name: query_structure

Status: done

Started: 2026-03-17 01:10:33
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDHYVITYGETGVGWVPGQTFTVPGSKSTATISGLKPGVDYTITVYAWNASIFSYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:31)
Show buried residues

Minimal score value
-3.5848
Maximal score value
2.5809
Average score
-0.3311
Total score value
-30.457

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7244
2 S A 0.4546
3 D A 0.3334
4 V A -0.0602
5 P A 0.0000
6 R A -3.5515
7 D A -3.5848
8 L A 0.0000
9 E A -2.1813
10 V A 0.1121
11 V A 1.5524
12 A A 0.9045
13 A A 0.3330
14 T A -0.3435
15 P A -1.1219
16 T A -1.0024
17 S A -0.5314
18 L A 0.0000
19 L A 0.7567
20 I A 0.0000
21 S A -1.1933
22 W A 0.0000
23 D A -3.3634
24 A A -1.7424
25 P A -0.5064
26 A A 0.1962
27 V A 0.5275
28 T A -0.3049
29 V A 0.0000
30 D A -1.6967
31 H A -1.2244
32 Y A 0.0000
33 V A 0.5196
34 I A 0.0000
35 T A -0.2313
36 Y A -0.4762
37 G A -0.3593
38 E A -0.8337
39 T A -0.6254
40 G A 0.1701
41 V A 1.4183
42 G A 0.8711
43 W A 1.5444
44 V A 1.2588
45 P A 0.1160
46 G A -0.1243
47 Q A -1.1245
48 T A -0.4009
49 F A 0.2447
50 T A 0.2085
51 V A 0.0000
52 P A -1.1756
53 G A -1.4416
54 S A -1.3982
55 K A -2.0272
56 S A -1.4231
57 T A -0.7391
58 A A 0.0000
59 T A 0.2399
60 I A 0.0000
61 S A -0.7849
62 G A -1.1577
63 L A 0.0000
64 K A -2.3912
65 P A -1.6578
66 G A -1.4412
67 V A -1.4441
68 D A -1.8976
69 Y A 0.0000
70 T A -0.8372
71 I A 0.0000
72 T A -0.0089
73 V A 0.0000
74 Y A 0.7699
75 A A 0.0000
76 W A 0.5943
77 N A 0.0000
78 A A 0.7266
79 S A 0.7018
80 I A 1.9167
81 F A 2.5809
82 S A 1.7478
83 Y A 1.8304
84 S A 0.0000
85 P A 0.2741
86 I A -0.0617
87 S A -0.6700
88 I A -0.7301
89 N A -1.7372
90 Y A -1.4557
91 R A -2.5222
92 T A -1.4993
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018