Project name: 8942c5ce756448d

Status: done

Started: 2024-07-05 13:14:58
Settings
Chain sequence(s) A: PRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKP
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:41)
Show buried residues

Minimal score value
-3.2015
Maximal score value
1.2779
Average score
-0.7879
Total score value
-168.6197

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
8 P A -1.3108
9 R A -2.6165
10 D A -2.7352
11 Y A -1.5063
12 N A -1.7773
13 P A -1.3618
14 I A 0.0000
15 S A 0.0000
16 S A -0.4444
17 T A 0.0000
18 I A 0.0000
19 C A 0.0000
20 H A -0.1586
21 L A 0.0000
22 T A -0.5873
23 N A 0.0000
24 E A -2.4528
25 S A 0.0000
26 D A -2.6523
27 G A -2.0396
28 H A -2.2745
29 T A -1.7320
30 T A 0.0000
31 S A -0.6363
32 L A 0.0000
33 Y A 0.0000
34 G A 0.0000
35 I A 0.0000
36 G A 0.0000
37 F A 0.0000
38 G A 0.0000
39 P A -1.0383
40 F A 0.0000
41 I A 0.0000
42 I A 0.0000
43 T A 0.0000
44 N A 0.0000
45 K A 0.0000
46 H A -0.6620
47 L A 0.0000
48 F A 0.0000
49 R A -1.8811
50 R A -2.9435
51 N A 0.0000
52 N A -2.6263
53 G A -2.3441
54 T A -1.9605
55 L A 0.0000
56 L A -0.4160
57 V A 0.0000
58 Q A 0.2593
59 S A 0.0000
60 L A 0.7453
61 H A -0.3280
62 G A 0.4031
63 V A 1.2779
64 F A -0.1981
65 K A -1.5368
66 V A 0.0000
67 K A -2.5020
68 N A -1.9503
69 T A 0.0000
70 T A -1.2176
71 T A -0.7969
72 L A 0.0000
73 Q A -0.9389
74 Q A 0.0000
75 H A 0.0000
76 L A -0.3407
77 I A 0.0000
78 D A -1.9522
79 G A -1.1782
80 R A -0.8998
81 D A 0.0000
82 M A 0.0000
83 I A 0.0000
84 I A 0.0000
85 I A 0.0000
86 R A -1.1086
87 M A 0.0000
88 P A -1.9422
89 K A -2.7590
90 D A -2.6829
91 F A 0.0000
92 P A -1.1949
93 P A -1.1301
94 F A 0.0000
95 P A -1.3530
96 Q A -2.3617
97 K A -2.6721
98 L A 0.0000
99 K A -1.7902
100 F A 0.0000
101 R A -1.2177
102 E A -1.5403
103 P A 0.0000
104 Q A -2.0661
105 R A -2.8016
106 E A -2.6922
107 E A 0.0000
108 R A -2.1233
109 I A 0.0000
110 C A 0.0000
111 L A 0.0000
112 V A 0.0000
113 T A 0.0000
114 T A 0.0000
115 N A -0.9571
116 F A -0.8609
117 Q A -1.7488
118 T A -1.3888
119 K A -2.0449
120 S A -1.3161
121 M A -0.4388
122 S A -0.2837
123 S A 0.0447
124 M A 0.5763
125 V A 0.1231
126 S A -0.6013
127 D A -1.8582
128 T A -0.9664
129 S A -0.3943
130 C A 0.0303
131 T A 0.0000
132 F A 0.6194
133 P A -0.1126
134 S A 0.0000
135 S A -1.0708
136 D A -1.9514
137 G A -0.8438
138 I A -0.8777
139 F A 0.0000
140 W A 0.0000
141 K A 0.3160
142 H A 0.0000
143 W A 0.0942
144 I A 0.0000
145 Q A -1.8523
146 T A -2.0606
147 K A -3.1683
148 D A -3.2015
149 G A -1.8192
150 Q A -1.7144
151 A A -0.8531
152 G A 0.0000
153 S A 0.0000
154 P A 0.0000
155 L A 0.0000
156 V A 0.0000
157 S A 0.0000
158 T A -1.7801
159 R A -2.4274
160 D A -1.5850
161 G A -1.2727
162 F A -0.5936
163 I A 0.0000
164 V A 0.0000
165 G A 0.0000
166 I A 0.0000
167 H A 0.0000
168 S A -0.2572
169 A A -0.6088
170 S A -0.8415
171 N A -0.1682
172 F A 0.8218
173 T A -0.1620
174 N A -1.4878
175 T A -0.6799
176 N A -0.6364
177 N A 0.0000
178 Y A 0.1288
179 F A 0.0000
180 T A 0.0000
181 S A 0.0000
182 V A 0.0000
183 P A -1.5301
184 K A -2.6691
185 N A -2.6606
186 F A 0.0000
187 M A -1.5422
188 E A -2.7394
189 L A -1.9878
190 L A 0.0000
191 T A -1.4609
192 N A -2.1404
193 Q A -2.7100
194 E A -2.9624
195 A A -2.1630
196 Q A -1.8043
197 Q A -1.4691
198 W A -0.4879
199 V A 0.1576
200 S A -0.2006
201 G A -0.7718
202 W A -0.7150
203 R A -1.8208
204 L A -1.6166
205 N A -2.0370
206 A A -1.5767
207 D A -1.7806
208 S A -0.6171
209 V A 0.1824
210 L A 0.9133
211 W A -0.1878
212 G A -0.7828
213 G A -0.9758
214 H A -0.6398
215 K A -0.9109
216 V A -0.3364
217 F A -0.0490
218 M A -0.5439
219 S A -1.0257
220 K A -1.4414
221 P A -0.6378
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018