Project name: query_structure

Status: done

Started: 2026-03-16 22:47:28
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVSYYVITYGETGGSYWHYQTFKVPGSKSTATISGLKPGVDYTITVYAYSPYYPAPYRSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)
Show buried residues

Minimal score value
-2.5399
Maximal score value
1.7874
Average score
-0.3398
Total score value
-32.2828

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7874
2 S A 0.7945
3 S A 0.4841
4 V A 0.2923
5 P A 0.0000
6 T A -1.2639
7 K A -2.3669
8 L A 0.0000
9 E A -1.7982
10 V A 0.1280
11 V A 1.5481
12 A A 0.8997
13 A A 0.3228
14 T A -0.3361
15 P A -1.1102
16 T A -0.9954
17 S A -0.5291
18 L A 0.0000
19 L A 0.7570
20 I A 0.0000
21 S A -0.7588
22 W A 0.0000
23 D A -1.6862
24 A A -0.7717
25 P A 0.2673
26 A A 0.5682
27 V A 0.7022
28 T A 0.2092
29 V A 0.0579
30 S A 0.1531
31 Y A -0.7750
32 Y A 0.0000
33 V A -0.4924
34 I A 0.0000
35 T A 0.0000
36 Y A -0.4163
37 G A 0.0000
38 E A -1.7722
39 T A -1.1342
40 G A -0.7963
41 G A -0.6414
42 S A 0.2534
43 Y A 1.1735
44 W A 1.1117
45 H A -0.4090
46 Y A -0.2747
47 Q A -0.9346
48 T A -0.7098
49 F A -0.4825
50 K A -1.3557
51 V A 0.0000
52 P A -1.0947
53 G A -0.8977
54 S A -1.1163
55 K A -1.9614
56 S A -1.1924
57 T A -0.6492
58 A A 0.0000
59 T A 0.2430
60 I A 0.0000
61 S A -0.6607
62 G A -1.0274
63 L A 0.0000
64 K A -2.3867
65 P A -1.6509
66 G A -1.4491
67 V A -1.4561
68 D A -2.1498
69 Y A 0.0000
70 T A -1.0110
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.0000
75 A A 0.0000
76 Y A -0.0974
77 S A 0.0000
78 P A 0.5817
79 Y A 1.5159
80 Y A 1.7227
81 P A 0.8686
82 A A 0.6751
83 P A 0.6416
84 Y A 0.7693
85 R A -1.0486
86 S A 0.0000
87 S A -0.3974
88 P A -0.2957
89 I A 0.0473
90 S A -0.5384
91 I A -0.7054
92 N A -1.7459
93 Y A -1.4768
94 R A -2.5399
95 T A -1.4989
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018