Project name: 8afc0159f5f7382

Status: done

Started: 2026-07-01 15:23:37
Settings
Chain sequence(s) B: SSRLLQTHTIQVSAGGPLSSVTWVFNGDATLTSSLTLPAGATERFRAESA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:15)
Show buried residues

Minimal score value
-3.0357
Maximal score value
1.7956
Average score
-0.7604
Total score value
-38.0188

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -0.8852
2 S B -1.4240
3 R B -2.1403
4 L B -1.3556
5 L B -0.7067
6 Q B -1.8028
7 T B -2.0126
8 H B -2.3342
9 T B -1.9882
10 I B 0.0000
11 Q B -1.9317
12 V B 0.0000
13 S B -0.8081
14 A B -0.6954
15 G B -0.6753
16 G B -0.5767
17 P B -0.4265
18 L B -0.0961
19 S B -0.1055
20 S B 0.0122
21 V B 0.5773
22 T B 0.8354
23 W B 1.5109
24 V B 1.7956
25 F B 0.6005
26 N B -1.0775
27 G B -1.3484
28 D B -1.7880
29 A B -0.1721
30 T B 0.8120
31 L B 1.6742
32 T B 0.7612
33 S B 0.2649
34 S B -0.0252
35 L B 0.3455
36 T B 0.0721
37 L B 0.0000
38 P B -0.6996
39 A B -0.7346
40 G B -1.0494
41 A B -1.1454
42 T B -1.6288
43 E B -2.3759
44 R B -3.0357
45 F B -2.4252
46 R B -2.8604
47 A B -1.7961
48 E B -2.6332
49 S B -1.6113
50 A B -0.9089
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018