Project name: FGF2

Chain sequence(s)	A: GINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQ
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:55)

• Minimal score value: -3.4816
• Maximal score value: 0.5091
• Average score: -1.9338
• Total score value: -143.0977

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
33	G	A	-1.0820
34	I	A	-0.1431
35	N	A	-2.3735
36	E	A	-3.2363
37	E	A	-3.1405
38	L	A	-2.0327
39	S	A	-2.5134
40	E	A	-3.2064
41	V	A	-1.4358
42	L	A	-1.9903
43	Q	A	-2.6024
44	T	A	-1.9132
45	L	A	-1.6921
46	Q	A	-2.6614
47	D	A	-3.4031
48	E	A	-2.7977
49	F	A	-2.0282
50	G	A	-1.5326
51	Q	A	-1.7482
52	M	A	0.0000
53	S	A	-0.3763
54	F	A	0.5091
55	D	A	-0.8336
56	H	A	-1.0563
57	Q	A	-1.2307
58	Q	A	-1.3497
59	L	A	-1.5040
60	A	A	-1.9857
61	K	A	-2.6882
62	L	A	-1.4840
63	I	A	0.0000
64	Q	A	-2.4656
65	E	A	-2.6257
66	S	A	0.0000
67	P	A	-0.6416
68	T	A	-0.2987
69	V	A	0.1234
70	E	A	-1.8218
71	L	A	-1.2661
72	K	A	-2.2911
73	D	A	-3.1936
74	K	A	-2.9689
75	L	A	0.0000
76	E	A	-3.2166
77	C	A	-2.3039
78	E	A	-2.7301
79	L	A	-2.4657
80	E	A	-2.4836
81	A	A	-1.8836
82	L	A	0.0000
83	V	A	-1.3449
84	G	A	-2.0912
85	R	A	-2.5152
86	M	A	-2.1242
87	E	A	-2.5960
88	A	A	-1.9129
89	K	A	-1.8954
90	A	A	-1.8013
91	N	A	-2.2705
92	Q	A	-1.9819
93	I	A	-1.6905
94	T	A	-2.1748
95	K	A	-2.9585
96	V	A	-1.9471
97	R	A	-3.1440
98	K	A	-3.2027
99	Y	A	-1.8094
100	Q	A	-2.1968
101	A	A	-2.7621
102	Q	A	-2.8304
103	L	A	-2.1862
104	E	A	-3.4816
105	K	A	-3.3743
106	Q	A	-2.7403