Project name: query_structure

Chain sequence(s)	A: ESCVWIPCITSAIGCSCKSKVCYRNGIPCG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:03)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:39)

• Minimal score value: -1.8749
• Maximal score value: 2.3973
• Average score: 0.2222
• Total score value: 6.6659

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	0.0953
2	S	A	0.2568
3	C	A	0.8510
4	V	A	1.0235
5	W	A	1.9787
6	I	A	2.3973
7	P	A	1.3895
8	C	A	0.0000
9	I	A	2.2783
10	T	A	1.2807
11	S	A	0.8836
12	A	A	1.2675
13	I	A	1.9030
14	G	A	0.2207
15	C	A	0.0000
16	S	A	-0.4119
17	C	A	-0.4777
18	K	A	-1.8749
19	S	A	-1.3382
20	K	A	-1.3128
21	V	A	-0.5832
22	C	A	0.0000
23	Y	A	-0.7305
24	R	A	-1.2266
25	N	A	-1.5261
26	G	A	-0.6973
27	I	A	0.9506
28	P	A	0.0424
29	C	A	0.2115
30	G	A	-0.1853