Project name: query_structure

Status: done

Started: 2026-03-16 20:06:42
Settings
Chain sequence(s) A: DTIPCGESCVWIPCISSILGCSCKDKVCYHN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:26)
Show buried residues

Minimal score value
-2.5827
Maximal score value
3.0491
Average score
0.2066
Total score value
6.4046

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.0627
2 T A -0.3889
3 I A 0.9919
4 P A 0.1276
5 C A 0.3505
6 G A -0.2672
7 E A 0.0778
8 S A 0.2195
9 C A 0.7705
10 V A 1.6770
11 W A 2.0026
12 I A 1.5947
13 P A 1.0560
14 C A 0.0000
15 I A 2.5684
16 S A 1.9691
17 S A 1.8483
18 I A 3.0491
19 L A 2.4453
20 G A 0.8547
21 C A 0.0000
22 S A -0.5779
23 C A -0.8492
24 K A -2.2989
25 D A -2.5827
26 K A -1.6665
27 V A -0.8947
28 C A 0.0000
29 Y A -1.0253
30 H A -0.8814
31 N A -1.7030
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018