Project name: Mb5-11_VVLLLF

Status: done

Started: 2026-07-06 06:32:35
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQVSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTLTVYAVTWYPRYGYGESGPLSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:48)
Show buried residues

Minimal score value
-2.7645
Maximal score value
1.5253
Average score
-0.7239
Total score value
-78.9056

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3993
2 Q A -0.9815
3 A A -1.1275
4 N A -1.9266
5 S A -1.2723
6 G A 0.0000
7 S A -1.2307
8 L A 0.0000
9 E A -1.9088
10 V A -0.7279
11 V A -0.3000
12 E A -1.5857
13 A A -1.2531
14 S A -1.4863
15 P A -1.8489
16 T A -1.2065
17 S A -1.1599
18 L A 0.0000
19 Q A -0.9496
20 V A 0.0000
21 S A -1.2016
22 W A 0.0000
23 D A -2.3530
24 A A -1.5489
25 F A 0.0000
26 H A -1.1450
27 R A 0.0000
28 Y A 0.9756
29 H A 0.3138
30 N A -0.5672
31 G A 0.1405
32 F A 1.5253
33 T A 0.7858
34 H A 0.0894
35 P A -0.4238
36 V A -1.0217
37 R A -1.5730
38 Y A -0.8707
39 Y A 0.0000
40 R A -0.8048
41 V A 0.0000
42 T A -0.6391
43 Y A -0.3393
44 G A -0.6334
45 E A -1.3781
46 T A -1.1190
47 G A -1.1580
48 G A -1.3015
49 N A -1.5142
50 S A -0.9004
51 P A -0.4083
52 V A 0.2922
53 Q A -1.2019
54 E A -1.8075
55 F A -0.6805
56 T A -0.1630
57 V A -0.4624
58 P A -1.0088
59 G A -1.3015
60 S A -1.3374
61 K A -2.0895
62 S A -1.2904
63 T A -0.9365
64 A A 0.0000
65 T A -0.3668
66 L A 0.0000
67 S A -0.7699
68 G A -0.9950
69 L A 0.0000
70 K A -2.4147
71 P A -2.0042
72 G A -1.2758
73 V A -1.1623
74 D A -2.0516
75 Y A 0.0000
76 T A -0.6178
77 L A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2304
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5370
85 Y A 0.0000
86 P A -0.3646
87 R A -1.0716
88 Y A 0.7064
89 G A 0.6741
90 Y A 1.1095
91 G A 0.3469
92 E A -0.5771
93 S A 0.0000
94 G A -0.7048
95 P A -0.3513
96 L A 0.0783
97 S A -0.2487
98 F A -0.1675
99 N A -1.4859
100 Y A -1.4635
101 R A -2.5056
102 T A 0.0000
103 E A -2.2467
104 L A -1.1510
105 D A -2.6534
106 K A -2.7645
107 P A -1.7859
108 S A -1.6421
109 Q A -1.6613
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018