Project name: HIL6

Status: done

Started: 2024-12-27 08:30:46
Settings
Chain sequence(s) A: LTSSERIDKQIRYILDGISALRKETCNKSNMCENLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:41)
Show buried residues

Minimal score value
-3.9086
Maximal score value
0.7228
Average score
-1.1742
Total score value
-184.3444

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
19 L A 0.7228
20 T A -0.1471
21 S A -0.9444
22 S A -1.2733
23 E A -1.8535
24 R A -1.4360
25 I A 0.0000
26 D A -2.1380
27 K A -1.7479
28 Q A 0.0000
29 I A 0.0000
30 R A -2.0633
31 Y A -0.4506
32 I A 0.0000
33 L A -1.5892
34 D A -1.9837
35 G A -1.0921
36 I A 0.0000
37 S A -1.7117
38 A A -1.5207
39 L A 0.0000
40 R A -2.7539
41 K A -3.1181
42 E A -2.4728
43 T A 0.0000
44 C A -2.7557
45 N A -3.1974
46 K A -3.1513
47 S A -1.7325
48 N A -2.4457
49 M A -0.9692
50 C A -1.6071
51 E A -1.8910
61 N A -1.5353
62 L A -0.8970
63 N A -1.9141
64 L A 0.0000
65 P A -1.6199
66 K A -2.1685
67 M A -1.6004
68 A A -1.7340
69 E A -2.7090
70 K A -2.6521
71 D A 0.0000
72 G A 0.0000
73 C A 0.0000
74 F A -1.3742
75 Q A -1.6684
76 S A -1.3160
77 G A -1.6047
78 F A -1.5250
79 N A -1.9730
80 E A -2.1529
81 E A -2.2710
82 T A -1.3576
83 C A 0.0000
84 L A 0.0000
85 V A -0.3089
86 K A -0.6217
87 I A 0.0000
88 I A 0.0000
89 T A -0.1961
90 G A 0.0000
91 L A 0.0000
92 L A -0.8002
93 E A -1.7292
94 F A 0.0000
95 E A -1.0350
96 V A 0.0000
97 Y A 0.0000
98 L A 0.0000
99 E A -1.8298
100 Y A 0.0000
101 L A 0.0000
102 Q A -3.0911
103 N A -2.7892
104 R A -2.1582
105 F A 0.0000
106 E A -3.1046
107 S A -1.9580
108 S A -2.4829
109 E A -3.9086
110 E A -3.6244
111 Q A -2.4383
112 A A 0.0000
113 R A -3.2643
114 A A -1.6868
115 V A 0.0000
116 Q A 0.0000
117 M A -0.4738
118 S A -0.2025
119 T A 0.0000
120 K A -1.0793
121 V A -0.3662
122 L A 0.0000
123 I A 0.0000
124 Q A -1.9068
125 F A -1.4102
126 L A 0.0000
127 Q A -2.6973
128 K A -3.2940
129 K A -2.4345
130 A A 0.0000
131 K A -3.4999
132 N A -2.9344
133 L A -2.1942
134 D A -2.0972
135 A A -0.9890
136 I A -0.1276
137 T A -0.3993
138 T A -0.6717
139 P A -1.2975
140 D A -1.9145
141 P A -1.1553
142 T A -0.7705
143 T A -0.7703
144 N A -1.0125
145 A A -0.6944
146 S A -0.5974
147 L A -0.5039
148 L A -0.8967
149 T A -1.0747
150 K A -1.9122
151 L A 0.0000
152 Q A -1.7374
153 A A -1.3874
154 Q A -1.5648
155 N A -1.6497
156 Q A -1.2726
157 W A 0.4303
158 L A 0.2545
159 Q A 0.0000
160 D A -0.4256
161 M A 0.6275
162 T A 0.0000
163 T A 0.0000
164 H A 0.0000
165 L A 0.0056
166 I A 0.0000
167 L A 0.0000
168 R A -2.0394
169 S A 0.0000
170 F A 0.0000
171 K A -2.5742
172 E A -3.0309
173 F A 0.0000
174 L A 0.0000
175 Q A -2.1002
176 S A -1.7726
177 S A 0.0000
178 L A -2.0900
179 R A -2.6573
180 A A 0.0000
181 L A -1.6363
182 R A -2.7207
183 Q A -2.0431
184 M A -1.1585
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018