Project name: 8c4373d8150b8cd

Chain sequence(s)	B: TSTRFRWESLDSSGNVISSQDHTIVGPAQIQNVSISYSSPSTLVVTLTLL
Selected Chain(s)	B
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:13)

• Minimal score value: -3.7777
• Maximal score value: 2.8686
• Average score: 0.0113
• Total score value: 0.5674

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	T	B	0.2552
2	S	B	0.1343
3	T	B	-0.6231
4	R	B	-2.2918
5	F	B	-2.1620
6	R	B	-3.3414
7	W	B	-1.6577
8	E	B	-1.3197
9	S	B	0.1284
10	L	B	0.9584
11	D	B	-0.1844
12	S	B	-0.6233
13	S	B	-0.7579
14	G	B	-0.6198
15	N	B	-0.4225
16	V	B	1.4179
17	I	B	2.0855
18	S	B	0.5843
19	S	B	-1.1687
20	Q	B	-2.9502
21	D	B	-3.7777
22	H	B	-2.4181
23	T	B	-1.1531
24	I	B	0.4477
25	V	B	1.3376
26	G	B	0.5134
27	P	B	0.1914
28	A	B	0.2853
29	Q	B	-0.6172
30	I	B	-0.0465
31	Q	B	-0.9463
32	N	B	-1.0628
33	V	B	0.6543
34	S	B	1.1990
35	I	B	2.8686
36	S	B	1.9024
37	Y	B	1.9404
38	S	B	0.9267
39	S	B	0.2197
40	P	B	-0.1047
41	S	B	-0.1144
42	T	B	0.5048
43	L	B	1.8337
44	V	B	2.2833
45	V	B	2.2007
46	T	B	1.1283
47	L	B	0.7714
48	T	B	0.1731
49	L	B	0.8550
50	L	B	1.1299