Project name: 8cc8b23c3884e0c

Chain sequence(s)	A: SKIKGSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:49)

• Minimal score value: -4.6146
• Maximal score value: 2.509
• Average score: -0.9815
• Total score value: -158.0158

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-1.0064
2	K	A	-1.8265
3	I	A	-0.7082
4	K	A	-1.8431
5	G	A	-1.2264
6	S	A	-1.0075
7	R	A	-1.2795
8	H	A	-1.5156
9	W	A	-0.5421
10	G	A	0.1132
11	F	A	1.0161
12	I	A	2.3618
13	L	A	0.0000
14	G	A	-2.1079
15	K	A	-4.1040
16	R	A	-3.9482
17	G	A	-2.4419
18	E	A	-2.9492
19	P	A	-1.3743
20	P	A	-1.2072
21	P	A	-1.5575
22	G	A	-1.7270
23	K	A	-2.8523
24	P	A	0.0000
25	A	A	-1.6491
26	D	A	-2.6426
27	D	A	-1.6254
28	A	A	-0.8864
29	G	A	-0.6416
30	L	A	-0.1669
31	V	A	0.0000
32	S	A	-0.6349
33	R	A	0.0000
34	H	A	-1.2456
35	W	A	0.0000
36	G	A	0.2591
37	F	A	0.0000
38	I	A	2.1389
39	L	A	0.0000
40	G	A	-2.1974
41	K	A	-3.8862
42	R	A	-4.6146
43	G	A	0.0000
44	E	A	-3.6548
45	P	A	0.0000
46	P	A	0.0000
47	P	A	-1.5890
48	G	A	-1.9520
49	K	A	-3.1699
50	P	A	0.0000
51	A	A	0.0000
52	D	A	-3.2886
53	D	A	0.0000
54	A	A	-0.7796
55	G	A	0.2302
56	L	A	0.9775
57	V	A	0.0000
58	S	A	-0.1221
59	R	A	0.0000
60	H	A	-1.0270
61	W	A	0.0000
62	G	A	0.1247
63	F	A	0.0000
64	I	A	1.8587
65	L	A	0.0000
66	G	A	-2.1188
67	K	A	-3.7466
68	R	A	-3.6488
69	G	A	0.0000
70	E	A	-3.5432
71	P	A	0.0000
72	P	A	0.0000
73	P	A	-1.6240
74	G	A	-1.8555
75	K	A	-3.1331
76	P	A	0.0000
77	A	A	0.0000
78	D	A	-3.2273
79	D	A	0.0000
80	A	A	-0.6731
81	G	A	0.0935
82	L	A	1.0418
83	V	A	0.0000
84	S	A	-0.0297
85	R	A	0.0000
86	H	A	-0.8485
87	W	A	-0.2659
88	G	A	0.2219
89	F	A	0.0000
90	I	A	1.7991
91	L	A	0.0000
92	G	A	-2.1987
93	K	A	-3.5761
94	R	A	-3.2033
95	G	A	0.0000
96	E	A	-3.0200
97	P	A	0.0000
98	P	A	-1.3815
99	P	A	-1.6333
100	G	A	-2.0184
101	K	A	-3.1917
102	P	A	-2.5338
103	A	A	0.0000
104	D	A	-3.2305
105	D	A	0.0000
106	A	A	-0.5489
107	G	A	0.2816
108	L	A	1.1749
109	V	A	0.0000
110	S	A	-0.0274
111	R	A	0.0000
112	H	A	-0.9414
113	W	A	-0.2826
114	G	A	0.5573
115	F	A	0.0000
116	I	A	2.1626
117	L	A	0.0000
118	G	A	-2.4258
119	K	A	-4.5034
120	R	A	-4.4912
121	G	A	0.0000
122	E	A	-2.5161
123	P	A	-1.2436
124	P	A	-1.1430
125	P	A	-1.5003
126	G	A	-1.8734
127	K	A	-2.5994
128	P	A	-1.9108
129	A	A	0.0000
130	D	A	-2.7853
131	D	A	-1.5153
132	A	A	-0.7535
133	G	A	-0.1004
134	L	A	1.5688
135	V	A	0.6258
136	S	A	0.0086
137	R	A	-1.0443
138	H	A	-1.1778
139	W	A	-0.0865
140	G	A	0.6324
141	F	A	1.3985
142	I	A	2.5090
143	L	A	-0.3686
144	G	A	-1.9965
145	K	A	-3.2476
146	R	A	-4.0753
147	G	A	-3.1667
148	E	A	-3.2521
149	P	A	-1.3053
150	P	A	-1.4327
151	P	A	-1.3605
152	G	A	-1.5767
153	K	A	-2.4247
154	P	A	-1.9001
155	A	A	-1.9923
156	D	A	-2.4261
157	D	A	-1.0872
158	A	A	-0.0601
159	G	A	0.7961
160	L	A	2.3987
161	V	A	2.4766