Project name: 8ccdc39df097330

Status: done

Started: 2026-06-22 16:02:58
Settings
Chain sequence(s) B: LAEVKAFVDGVMAATKVMAEMAKQNGNEELLKKVKEFQKKMEAKGKEILA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:17)
Show buried residues

Minimal score value
-4.3453
Maximal score value
1.2947
Average score
-1.6915
Total score value
-84.5746

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L B 1.2947
2 A B -0.0483
3 E B -1.1507
4 V B 0.1241
5 K B -0.8294
6 A B -0.4887
7 F B 0.4909
8 V B 0.0000
9 D B -1.2634
10 G B -0.4741
11 V B -0.2001
12 M B -0.5981
13 A B -0.1776
14 A B 0.0642
15 T B 0.0000
16 K B -1.1684
17 V B 0.5067
18 M B -0.0317
19 A B 0.0000
20 E B -2.2370
21 M B -1.3123
22 A B 0.0000
23 K B -3.8517
24 Q B -3.2525
25 N B -3.1010
26 G B -3.1288
27 N B -3.3828
28 E B -4.3453
29 E B -3.9785
30 L B -2.8776
31 L B -3.8239
32 K B -4.3205
33 K B -3.6746
34 V B 0.0000
35 K B -3.5623
36 E B -3.9052
37 F B -2.2968
38 Q B -3.1191
39 K B -3.8118
40 K B -3.7601
41 M B 0.0000
42 E B -3.7954
43 A B -3.0559
44 K B -3.0425
45 G B 0.0000
46 K B -3.1405
47 E B -2.6292
48 I B -0.5884
49 L B -0.1095
50 A B -0.5215
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018