| Chain sequence(s) |
A: MITSVWTKGVTPLTPEQFRYNNEDVIHAPYLAHQGWYDITKAFDGKDNLLCGAATAGNMLHWWFDQNKTEIEAYLSKHPDKQKIIFNNQELFDLKAAIDTKDSQTNSQLFNYFRDKAFPNLSARQLGVMPDLVLDMFINGYYLNVFKTQSTDVNRPYQDKDKRGGIFDAVFTRGDQTTLLTARHDLKNKGLNDISTIIKQELTEGRALALSHTYANVSISHVINLWGADFNAEGNLEAIYVTDSDANASIGMKKYFVGINAHGHVAISAKKIEGENIGAQVLGLFTLSSGKDIWQKLS
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:00)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:00)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:00)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:00)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:03:28)
[INFO] Auto_mut: Residue number 2 from chain A and a score of 1.911 (isoleucine) selected
for automated muatation (00:03:29)
[INFO] Auto_mut: Residue number 1 from chain A and a score of 1.646 omitted from automated
muatation (excluded by the user). (00:03:29)
[INFO] Auto_mut: Residue number 3 from chain A and a score of 0.903 (threonine) selected for
automated muatation (00:03:29)
[INFO] Auto_mut: Residue number 219 from chain A and a score of 0.860 (isoleucine) selected
for automated muatation (00:03:29)
[INFO] Auto_mut: Residue number 146 from chain A and a score of 0.824 (phenylalanine)
selected for automated muatation (00:03:29)
[INFO] Auto_mut: Residue number 31 from chain A and a score of 0.819 (leucine) selected for
automated muatation (00:03:29)
[INFO] Auto_mut: Residue number 217 from chain A and a score of 0.775 (valine) selected for
automated muatation (00:03:29)
[INFO] Auto_mut: Mutating residue number 2 from chain A (isoleucine) into glutamic acid (00:03:29)
[INFO] Auto_mut: Mutating residue number 2 from chain A (isoleucine) into aspartic acid (00:03:29)
[INFO] Auto_mut: Mutating residue number 3 from chain A (threonine) into glutamic acid (00:03:29)
[INFO] Auto_mut: Mutating residue number 2 from chain A (isoleucine) into lysine (00:04:59)
[INFO] Auto_mut: Mutating residue number 2 from chain A (isoleucine) into arginine (00:05:00)
[INFO] Auto_mut: Mutating residue number 3 from chain A (threonine) into lysine (00:05:08)
[INFO] Auto_mut: Mutating residue number 3 from chain A (threonine) into aspartic acid (00:06:35)
[INFO] Auto_mut: Mutating residue number 219 from chain A (isoleucine) into glutamic acid (00:06:42)
[INFO] Auto_mut: Mutating residue number 219 from chain A (isoleucine) into aspartic acid (00:06:58)
[INFO] Auto_mut: Mutating residue number 3 from chain A (threonine) into arginine (00:08:03)
[INFO] Auto_mut: Mutating residue number 219 from chain A (isoleucine) into lysine (00:08:23)
[INFO] Auto_mut: Mutating residue number 219 from chain A (isoleucine) into arginine (00:08:33)
[INFO] Auto_mut: Mutating residue number 146 from chain A (phenylalanine) into glutamic acid
Mutating residue number 146 from chain A (phenylalanine) into glutamic acid (00:09:51)
[INFO] Auto_mut: Mutating residue number 146 from chain A (phenylalanine) into aspartic acid
Mutating residue number 146 from chain A (phenylalanine) into aspartic acid (00:10:10)
[INFO] Auto_mut: Mutating residue number 31 from chain A (leucine) into glutamic acid (00:10:27)
[INFO] Auto_mut: Mutating residue number 146 from chain A (phenylalanine) into arginine (00:11:44)
[INFO] Auto_mut: Mutating residue number 146 from chain A (phenylalanine) into lysine (00:11:46)
[INFO] Auto_mut: Mutating residue number 31 from chain A (leucine) into lysine (00:12:05)
[INFO] Auto_mut: Mutating residue number 31 from chain A (leucine) into aspartic acid (00:13:34)
[INFO] Auto_mut: Mutating residue number 217 from chain A (valine) into glutamic acid (00:13:43)
[INFO] Auto_mut: Mutating residue number 217 from chain A (valine) into aspartic acid (00:13:53)
[INFO] Auto_mut: Mutating residue number 31 from chain A (leucine) into arginine (00:15:08)
[INFO] Auto_mut: Mutating residue number 217 from chain A (valine) into lysine (00:15:20)
[INFO] Auto_mut: Mutating residue number 217 from chain A (valine) into arginine (00:15:25)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (isoleucine) into glutamic
acid: Energy difference: 1.2251 kcal/mol, Difference in average score from
the base case: -0.0483 (00:17:04)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (isoleucine) into lysine:
Energy difference: 0.2378 kcal/mol, Difference in average score from the
base case: -0.0441 (00:17:04)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (isoleucine) into aspartic
acid: Energy difference: 1.5868 kcal/mol, Difference in average score from
the base case: -0.0533 (00:17:04)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (isoleucine) into
arginine: Energy difference: 0.5040 kcal/mol, Difference in average score
from the base case: -0.0431 (00:17:04)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain A (threonine) into glutamic
acid: Energy difference: 0.0587 kcal/mol, Difference in average score from
the base case: -0.0203 (00:17:04)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain A (threonine) into lysine:
Energy difference: -0.3595 kcal/mol, Difference in average score from the
base case: -0.0140 (00:17:04)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain A (threonine) into aspartic
acid: Energy difference: 0.0110 kcal/mol, Difference in average score from
the base case: -0.0230 (00:17:04)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain A (threonine) into arginine:
Energy difference: 0.0342 kcal/mol, Difference in average score from the
base case: -0.0208 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 219 from chain A (isoleucine) into
glutamic acid: Energy difference: 1.1229 kcal/mol, Difference in average
score from the base case: -0.0053 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 219 from chain A (isoleucine) into
lysine: Energy difference: 0.8604 kcal/mol, Difference in average score
from the base case: -0.0102 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 219 from chain A (isoleucine) into
aspartic acid: Energy difference: 1.1223 kcal/mol, Difference in average
score from the base case: -0.0119 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 219 from chain A (isoleucine) into
arginine: Energy difference: 0.9506 kcal/mol, Difference in average score
from the base case: -0.0300 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 146 from chain A (phenylalanine) into
glutamic acid: Energy difference: -0.2338 kcal/mol, Difference in average
score from the base case: -0.0355 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 146 from chain A (phenylalanine) into
lysine: Energy difference: -0.0273 kcal/mol, Difference in average score
from the base case: -0.0377 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 146 from chain A (phenylalanine) into
aspartic acid: Energy difference: -0.3450 kcal/mol, Difference in average
score from the base case: -0.0385 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 146 from chain A (phenylalanine) into
arginine: Energy difference: 0.2747 kcal/mol, Difference in average score
from the base case: -0.0389 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 31 from chain A (leucine) into glutamic
acid: Energy difference: 0.2684 kcal/mol, Difference in average score from
the base case: -0.0383 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 31 from chain A (leucine) into lysine:
Energy difference: -0.1621 kcal/mol, Difference in average score from the
base case: -0.0367 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 31 from chain A (leucine) into aspartic
acid: Energy difference: 0.2573 kcal/mol, Difference in average score from
the base case: -0.0381 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 31 from chain A (leucine) into arginine:
Energy difference: -0.6178 kcal/mol, Difference in average score from the
base case: -0.0374 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 217 from chain A (valine) into glutamic
acid: Energy difference: -0.1461 kcal/mol, Difference in average score from
the base case: -0.0429 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 217 from chain A (valine) into lysine:
Energy difference: -0.1942 kcal/mol, Difference in average score from the
base case: -0.0343 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 217 from chain A (valine) into aspartic
acid: Energy difference: -0.4037 kcal/mol, Difference in average score from
the base case: -0.0382 (00:17:05)
[INFO] Auto_mut: Effect of mutation residue number 217 from chain A (valine) into arginine:
Energy difference: -0.2667 kcal/mol, Difference in average score from the
base case: -0.0404 (00:17:05)
[INFO] Main: Simulation completed successfully. (00:17:12)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | M | A | 1.6458 | |
| 2 | I | A | 1.9109 | |
| 3 | T | A | 0.9033 | |
| 4 | S | A | 0.2776 | |
| 5 | V | A | -0.3393 | |
| 6 | W | A | -0.5127 | |
| 7 | T | A | 0.0000 | |
| 8 | K | A | -2.3112 | |
| 9 | G | A | -1.5334 | |
| 10 | V | A | 0.0000 | |
| 11 | T | A | -0.7598 | |
| 12 | P | A | -0.5490 | |
| 13 | L | A | 0.0000 | |
| 14 | T | A | -0.9222 | |
| 15 | P | A | -1.5104 | |
| 16 | E | A | -2.4457 | |
| 17 | Q | A | -1.8001 | |
| 18 | F | A | -1.4306 | |
| 19 | R | A | -2.2063 | |
| 20 | Y | A | -1.4218 | |
| 21 | N | A | -2.1233 | |
| 22 | N | A | -2.9439 | |
| 23 | E | A | -3.5617 | |
| 24 | D | A | -3.2197 | |
| 25 | V | A | 0.0000 | |
| 26 | I | A | -0.9988 | |
| 27 | H | A | 0.0000 | |
| 28 | A | A | 0.0000 | |
| 29 | P | A | -0.0037 | |
| 30 | Y | A | 0.4852 | |
| 31 | L | A | 0.8188 | |
| 32 | A | A | -0.1574 | |
| 33 | H | A | -1.0525 | |
| 34 | Q | A | -0.6768 | |
| 35 | G | A | -1.0230 | |
| 36 | W | A | 0.0000 | |
| 37 | Y | A | 0.0000 | |
| 38 | D | A | 0.0000 | |
| 39 | I | A | 0.0000 | |
| 40 | T | A | -0.5369 | |
| 41 | K | A | 0.0000 | |
| 42 | A | A | -0.7054 | |
| 43 | F | A | -0.3223 | |
| 44 | D | A | -1.8941 | |
| 45 | G | A | -1.7988 | |
| 46 | K | A | -2.2445 | |
| 47 | D | A | 0.0000 | |
| 48 | N | A | -1.4317 | |
| 49 | L | A | -0.7116 | |
| 50 | L | A | 0.0000 | |
| 51 | C | A | -0.1955 | |
| 52 | G | A | 0.0000 | |
| 53 | A | A | 0.0000 | |
| 54 | A | A | 0.0000 | |
| 55 | T | A | 0.0000 | |
| 56 | A | A | 0.0000 | |
| 57 | G | A | 0.0000 | |
| 58 | N | A | 0.0000 | |
| 59 | M | A | 0.0000 | |
| 60 | L | A | 0.0000 | |
| 61 | H | A | 0.0000 | |
| 62 | W | A | 0.0000 | |
| 63 | W | A | 0.0000 | |
| 64 | F | A | 0.0000 | |
| 65 | D | A | -1.2830 | |
| 66 | Q | A | -1.2356 | |
| 67 | N | A | 0.0000 | |
| 68 | K | A | -1.6463 | |
| 69 | T | A | -1.3215 | |
| 70 | E | A | -1.4168 | |
| 71 | I | A | 0.0000 | |
| 72 | E | A | -2.6001 | |
| 73 | A | A | -1.6423 | |
| 74 | Y | A | 0.0000 | |
| 75 | L | A | 0.0000 | |
| 76 | S | A | -1.9401 | |
| 77 | K | A | -2.5094 | |
| 78 | H | A | -2.1891 | |
| 79 | P | A | -2.2660 | |
| 80 | D | A | -2.6379 | |
| 81 | K | A | -2.0325 | |
| 82 | Q | A | -1.8292 | |
| 83 | K | A | -1.9679 | |
| 84 | I | A | 0.0000 | |
| 85 | I | A | -0.9861 | |
| 86 | F | A | -0.4162 | |
| 87 | N | A | -1.6615 | |
| 88 | N | A | -2.1885 | |
| 89 | Q | A | -2.3090 | |
| 90 | E | A | -2.3581 | |
| 91 | L | A | -1.2581 | |
| 92 | F | A | 0.0000 | |
| 93 | D | A | -1.4447 | |
| 94 | L | A | 0.0000 | |
| 95 | K | A | -2.3051 | |
| 96 | A | A | -1.5586 | |
| 97 | A | A | 0.0000 | |
| 98 | I | A | -1.5496 | |
| 99 | D | A | -2.2425 | |
| 100 | T | A | -1.6193 | |
| 101 | K | A | -1.4552 | |
| 102 | D | A | -1.0712 | |
| 103 | S | A | -1.0891 | |
| 104 | Q | A | -0.8454 | |
| 105 | T | A | -1.0633 | |
| 106 | N | A | -1.6263 | |
| 107 | S | A | 0.0000 | |
| 108 | Q | A | -1.3452 | |
| 109 | L | A | 0.0000 | |
| 110 | F | A | 0.0000 | |
| 111 | N | A | -1.1717 | |
| 112 | Y | A | 0.0000 | |
| 113 | F | A | 0.0000 | |
| 114 | R | A | -1.6737 | |
| 115 | D | A | -1.4441 | |
| 116 | K | A | -1.6891 | |
| 117 | A | A | 0.0000 | |
| 118 | F | A | 0.0000 | |
| 119 | P | A | -1.8049 | |
| 120 | N | A | -2.3944 | |
| 121 | L | A | 0.0000 | |
| 122 | S | A | -2.0662 | |
| 123 | A | A | -1.9845 | |
| 124 | R | A | -2.7316 | |
| 125 | Q | A | -2.1424 | |
| 126 | L | A | -0.7870 | |
| 127 | G | A | -0.3071 | |
| 128 | V | A | 0.0000 | |
| 129 | M | A | -0.2046 | |
| 130 | P | A | 0.0000 | |
| 131 | D | A | 0.0000 | |
| 132 | L | A | -0.0937 | |
| 133 | V | A | 0.0000 | |
| 134 | L | A | 0.0000 | |
| 135 | D | A | 0.0000 | |
| 136 | M | A | 0.0000 | |
| 137 | F | A | 0.0000 | |
| 138 | I | A | 0.0000 | |
| 139 | N | A | 0.0000 | |
| 140 | G | A | 0.0000 | |
| 141 | Y | A | 0.0000 | |
| 142 | Y | A | 0.3627 | |
| 143 | L | A | 0.0000 | |
| 144 | N | A | -0.7035 | |
| 145 | V | A | 0.3463 | |
| 146 | F | A | 0.8240 | |
| 147 | K | A | -1.2361 | |
| 148 | T | A | -1.0097 | |
| 149 | Q | A | -1.6248 | |
| 150 | S | A | -1.0796 | |
| 151 | T | A | -1.3065 | |
| 152 | D | A | -1.9267 | |
| 153 | V | A | -1.9611 | |
| 154 | N | A | -2.6027 | |
| 155 | R | A | -2.3283 | |
| 156 | P | A | -1.0828 | |
| 157 | Y | A | 0.0328 | |
| 158 | Q | A | -1.0123 | |
| 159 | D | A | -1.3263 | |
| 160 | K | A | -1.3226 | |
| 161 | D | A | 0.0000 | |
| 162 | K | A | -1.3972 | |
| 163 | R | A | -0.8116 | |
| 164 | G | A | 0.0000 | |
| 165 | G | A | 0.0000 | |
| 166 | I | A | 0.0000 | |
| 167 | F | A | 0.0000 | |
| 168 | D | A | -0.4611 | |
| 169 | A | A | -0.2299 | |
| 170 | V | A | 0.0000 | |
| 171 | F | A | 0.0000 | |
| 172 | T | A | -0.7549 | |
| 173 | R | A | -1.4490 | |
| 174 | G | A | -1.9045 | |
| 175 | D | A | -1.7183 | |
| 176 | Q | A | -1.8815 | |
| 177 | T | A | -0.8393 | |
| 178 | T | A | 0.0000 | |
| 179 | L | A | -0.4619 | |
| 180 | L | A | 0.0000 | |
| 181 | T | A | 0.0000 | |
| 182 | A | A | -0.2524 | |
| 183 | R | A | -1.0678 | |
| 184 | H | A | -1.4434 | |
| 185 | D | A | -2.7491 | |
| 186 | L | A | 0.0000 | |
| 187 | K | A | -2.9801 | |
| 188 | N | A | -2.9871 | |
| 189 | K | A | -2.8310 | |
| 190 | G | A | -1.8525 | |
| 191 | L | A | -1.2608 | |
| 192 | N | A | -2.3779 | |
| 193 | D | A | -2.4427 | |
| 194 | I | A | 0.0000 | |
| 195 | S | A | 0.0000 | |
| 196 | T | A | -1.3577 | |
| 197 | I | A | -0.9365 | |
| 198 | I | A | 0.0000 | |
| 199 | K | A | -1.5967 | |
| 200 | Q | A | -1.8901 | |
| 201 | E | A | 0.0000 | |
| 202 | L | A | 0.0000 | |
| 203 | T | A | -1.7951 | |
| 204 | E | A | -2.6335 | |
| 205 | G | A | -1.9558 | |
| 206 | R | A | -1.4209 | |
| 207 | A | A | 0.0000 | |
| 208 | L | A | 0.0000 | |
| 209 | A | A | 0.0000 | |
| 210 | L | A | 0.0000 | |
| 211 | S | A | 0.0000 | |
| 212 | H | A | 0.0000 | |
| 213 | T | A | 0.1976 | |
| 214 | Y | A | 0.7338 | |
| 215 | A | A | 0.1760 | |
| 216 | N | A | -0.4938 | |
| 217 | V | A | 0.7754 | |
| 218 | S | A | 0.4860 | |
| 219 | I | A | 0.8595 | |
| 220 | S | A | 0.5178 | |
| 221 | H | A | 0.0000 | |
| 222 | V | A | 0.0000 | |
| 223 | I | A | 0.0000 | |
| 224 | N | A | 0.0000 | |
| 225 | L | A | 0.0000 | |
| 226 | W | A | 0.0000 | |
| 227 | G | A | 0.0000 | |
| 228 | A | A | 0.0000 | |
| 229 | D | A | 0.0000 | |
| 230 | F | A | 0.0000 | |
| 231 | N | A | -0.1870 | |
| 232 | A | A | -0.2485 | |
| 233 | E | A | -1.8795 | |
| 234 | G | A | -1.3290 | |
| 235 | N | A | -1.5099 | |
| 236 | L | A | 0.0000 | |
| 237 | E | A | -0.5581 | |
| 238 | A | A | 0.0000 | |
| 239 | I | A | 0.0000 | |
| 240 | Y | A | 0.0000 | |
| 241 | V | A | 0.0000 | |
| 242 | T | A | 0.0000 | |
| 243 | D | A | 0.0000 | |
| 244 | S | A | 0.0000 | |
| 245 | D | A | -0.7967 | |
| 246 | A | A | -0.8346 | |
| 247 | N | A | -1.3744 | |
| 248 | A | A | -0.6987 | |
| 249 | S | A | -0.4469 | |
| 250 | I | A | -0.3282 | |
| 251 | G | A | 0.0000 | |
| 252 | M | A | 0.0000 | |
| 253 | K | A | 0.0000 | |
| 254 | K | A | -0.1881 | |
| 255 | Y | A | -0.3534 | |
| 256 | F | A | -0.5459 | |
| 257 | V | A | 0.0000 | |
| 258 | G | A | 0.1049 | |
| 259 | I | A | 0.7701 | |
| 260 | N | A | 0.0000 | |
| 261 | A | A | -0.7926 | |
| 262 | H | A | -0.9212 | |
| 263 | G | A | -0.7996 | |
| 264 | H | A | -1.0760 | |
| 265 | V | A | 0.0000 | |
| 266 | A | A | 0.0000 | |
| 267 | I | A | 0.0000 | |
| 268 | S | A | -0.5235 | |
| 269 | A | A | -1.3840 | |
| 270 | K | A | -2.4954 | |
| 271 | K | A | -2.2161 | |
| 272 | I | A | -1.4285 | |
| 273 | E | A | -2.6370 | |
| 274 | G | A | -2.1917 | |
| 275 | E | A | -2.3116 | |
| 276 | N | A | -1.7997 | |
| 277 | I | A | -0.3762 | |
| 278 | G | A | -0.2556 | |
| 279 | A | A | 0.1029 | |
| 280 | Q | A | -0.2652 | |
| 281 | V | A | 0.0000 | |
| 282 | L | A | -1.3321 | |
| 283 | G | A | 0.0000 | |
| 284 | L | A | 0.0000 | |
| 285 | F | A | 0.0000 | |
| 286 | T | A | 0.0000 | |
| 287 | L | A | 0.0000 | |
| 288 | S | A | -0.7194 | |
| 289 | S | A | -0.8674 | |
| 290 | G | A | 0.0000 | |
| 291 | K | A | -1.9248 | |
| 292 | D | A | -2.5742 | |
| 293 | I | A | -1.4508 | |
| 294 | W | A | 0.0000 | |
| 295 | Q | A | -2.2937 | |
| 296 | K | A | -2.0146 | |
| 297 | L | A | 0.0817 | |
| 298 | S | A | -0.3557 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| LR31A | -0.6178 | -0.0374 | View | CSV | PDB |
| VD217A | -0.4037 | -0.0382 | View | CSV | PDB |
| FD146A | -0.345 | -0.0385 | View | CSV | PDB |
| VR217A | -0.2667 | -0.0404 | View | CSV | PDB |
| FE146A | -0.2338 | -0.0355 | View | CSV | PDB |
| LK31A | -0.1621 | -0.0367 | View | CSV | PDB |
| TK3A | -0.3595 | -0.014 | View | CSV | PDB |
| TD3A | 0.011 | -0.023 | View | CSV | PDB |
| IK2A | 0.2378 | -0.0441 | View | CSV | PDB |
| IR2A | 0.504 | -0.0431 | View | CSV | PDB |
| IR219A | 0.9506 | -0.03 | View | CSV | PDB |
| IK219A | 0.8604 | -0.0102 | View | CSV | PDB |