Project name: test

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFTLSDYYMSWVRQAPGKGLEWMGIIYPGDSDTRYSPSFQGHVTISRDDSKNTLYLQMNSLRAEDTAVYYCTRWGAGKDVWGQGTTVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -2.7111
• Maximal score value: 1.1388
• Average score: -0.708
• Total score value: -82.1336

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9591
2	V	A	-0.8788
3	Q	A	-1.1111
4	L	A	0.0000
5	V	A	0.6972
6	E	A	0.0000
7	S	A	-0.5109
8	G	A	-0.8147
9	G	A	-0.3970
10	G	A	0.4177
11	L	A	1.1388
12	V	A	-0.0245
13	Q	A	-1.3598
14	P	A	-1.6589
15	G	A	-1.5210
16	G	A	-1.0895
17	S	A	-1.4046
18	L	A	-1.0201
19	R	A	-2.1485
20	L	A	0.0000
21	S	A	-0.4345
22	C	A	0.0000
23	A	A	-0.2098
24	A	A	-0.3762
25	S	A	-0.7365
26	G	A	-1.0996
27	F	A	-0.6416
28	T	A	-0.8168
29	L	A	0.0000
30	S	A	-1.5915
31	D	A	-1.7317
32	Y	A	0.0707
33	Y	A	0.6657
34	M	A	0.0000
35	S	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-0.5708
40	A	A	-1.1999
41	P	A	-1.3308
42	G	A	-1.4384
43	K	A	-2.1242
44	G	A	-0.9451
45	L	A	0.5515
46	E	A	-0.2228
47	W	A	0.5293
48	M	A	0.0000
49	G	A	0.0000
50	I	A	0.0000
51	I	A	0.0000
52	Y	A	-0.6039
53	P	A	-1.0236
54	G	A	-1.8956
55	D	A	-2.3960
56	S	A	-1.7082
57	D	A	-1.6106
58	T	A	-1.3074
59	R	A	-2.0332
60	Y	A	-1.1613
61	S	A	-0.7661
62	P	A	-1.0246
63	S	A	-0.7370
64	F	A	0.0000
65	Q	A	-1.8275
66	G	A	-1.2611
67	H	A	-1.0709
68	V	A	0.0000
69	T	A	-0.9909
70	I	A	0.0000
71	S	A	-0.6173
72	R	A	-1.2334
73	D	A	-2.0625
74	D	A	-2.7111
75	S	A	-2.0686
76	K	A	-2.6204
77	N	A	-1.9307
78	T	A	-1.1998
79	L	A	0.0000
80	Y	A	-0.6159
81	L	A	0.0000
82	Q	A	-1.3087
83	M	A	0.0000
84	N	A	-1.7150
85	S	A	-1.3676
86	L	A	0.0000
87	R	A	-2.2159
88	A	A	-1.6775
89	E	A	-2.2131
90	D	A	0.0000
91	T	A	-0.6572
92	A	A	0.0000
93	V	A	0.2586
94	Y	A	0.0000
95	Y	A	0.4790
96	C	A	0.0000
97	T	A	0.0000
98	R	A	-0.0022
99	W	A	0.6488
100	G	A	-0.3163
101	A	A	-0.7956
102	G	A	-1.4096
103	K	A	-2.1551
104	D	A	-1.3614
105	V	A	-0.4278
106	W	A	0.3001
107	G	A	0.0000
108	Q	A	-0.7949
109	G	A	-0.2212
110	T	A	-0.1835
111	T	A	0.1125
112	V	A	0.0000
113	T	A	-0.0321
114	V	A	0.0000
115	S	A	-0.7464
116	S	A	-0.5561