Project name: 8dd001013403941

Status: done

Started: 2026-05-06 20:10:43
Settings
Chain sequence(s) A: DNGNLWTFIGKAIGSTARSWAEGAMFAPAIGPAKEIVDKLNGN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:23)
Show buried residues

Minimal score value
-2.7108
Maximal score value
2.5952
Average score
-0.2144
Total score value
-9.2178

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.7108
2 N A -2.2354
3 G A -1.0225
4 N A -0.8655
5 L A 0.9264
6 W A 1.4796
7 T A 0.7688
8 F A 2.1473
9 I A 1.8524
10 G A 0.7366
11 K A -0.2076
12 A A 0.8073
13 I A 1.4366
14 G A -0.0530
15 S A -0.4406
16 T A 0.2565
17 A A -0.4586
18 R A -1.7785
19 S A -0.4224
20 W A 0.2309
21 A A -1.1023
22 E A -1.9917
23 G A -0.6677
24 A A 0.4686
25 M A 1.8687
26 F A 2.5952
27 A A 1.7577
28 P A 1.5322
29 A A 0.7946
30 I A 1.1175
31 G A -0.2730
32 P A -0.5135
33 A A -0.3266
34 K A -1.6793
35 E A -2.1991
36 I A 0.1626
37 V A -0.1169
38 D A -2.6575
39 K A -2.3339
40 L A -0.4581
41 N A -1.8207
42 G A -1.8993
43 N A -1.9228
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018