Project name: query_structure

Status: done

Started: 2026-03-16 23:36:47
Settings
Chain sequence(s) A: GSSVSSVPTKLEVVAATPTSLLISWDASSSSVSHYEITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVYAYYSHEDIFYAVSPSSINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:25)
Show buried residues

Minimal score value
-2.6385
Maximal score value
2.4959
Average score
-0.3317
Total score value
-32.1744

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.4210
2 S A -0.1071
3 S A 0.3537
4 V A 1.4822
5 S A 0.5702
6 S A 0.2034
7 V A -0.1509
8 P A 0.0000
9 T A -1.2967
10 K A -2.6385
11 L A 0.0000
12 E A -1.6474
13 V A 0.2581
14 V A 1.6228
15 A A 0.9360
16 A A 0.2970
17 T A -0.3861
18 P A -0.8078
19 T A -0.5278
20 S A -0.3137
21 L A 0.0000
22 L A 0.7888
23 I A 0.0000
24 S A -0.6925
25 W A 0.0000
26 D A -2.5416
27 A A -1.2242
28 S A -0.8442
29 S A -0.6022
30 S A -0.3943
31 S A -0.3837
32 V A 0.0000
33 S A 0.0941
34 H A -0.0964
35 Y A 0.0000
36 E A -0.4855
37 I A 0.0000
38 T A -0.4839
39 Y A -0.2946
40 G A 0.0000
41 E A -1.3031
42 T A -1.2002
43 G A -1.2122
44 G A -1.3333
45 N A -1.5367
46 S A -0.8518
47 P A -0.3135
48 V A 0.4590
49 Q A -0.8104
50 E A -1.6028
51 F A -0.5716
52 T A -0.2694
53 V A -0.0786
54 P A -0.4191
55 G A -0.4418
56 S A -0.4425
57 S A -0.4737
58 S A -0.6636
59 T A -0.2201
60 A A 0.0000
61 T A 0.2373
62 I A 0.0000
63 S A -0.4727
64 G A -0.6839
65 L A 0.0000
66 S A -0.8262
67 P A -0.9846
68 G A -1.0731
69 V A -0.9126
70 D A -1.7981
71 Y A 0.0000
72 T A -0.7584
73 I A 0.0000
74 T A -0.3976
75 V A 0.0000
76 Y A 0.4107
77 A A 0.0000
78 Y A 1.2363
79 Y A 0.9146
80 S A 0.2308
81 H A -0.7381
82 E A -2.1212
83 D A -1.4476
84 I A 1.2874
85 F A 2.4959
86 Y A 2.3220
87 A A 1.4348
88 V A 0.7830
89 S A 0.0839
90 P A -0.0214
91 S A -0.4419
92 S A -0.6383
93 I A -0.7451
94 N A -1.6713
95 Y A -1.3801
96 R A -2.3087
97 T A -1.1710
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018