Project name: F12

Status: done

Started: 2025-06-26 16:47:32
Settings
Chain sequence(s) A: QVQLQQSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKAFRSYYYDSSGYLQPFDYWGQGTLVTVSS
B: QLVLTQSPSVSVAPGKTARITCGGNNIGSKSVHWYHQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHAVFGGGTKLTVL
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:58)
Show buried residues

Minimal score value
-3.1294
Maximal score value
1.5441
Average score
-0.6475
Total score value
-152.1631

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4874
2 V A -0.9422
3 Q A -1.5650
4 L A 0.0000
5 Q A -1.6796
6 Q A 0.0000
7 S A -0.8579
8 G A -0.7535
9 G A 0.0751
10 G A 0.5814
11 L A 1.3201
12 V A 0.0000
13 Q A -1.4395
14 P A -1.8601
15 G A -1.4988
16 G A -1.1155
17 S A -1.4759
18 L A -0.9654
19 R A -2.0347
20 L A 0.0000
21 S A -0.8081
22 C A 0.0000
23 A A -1.0098
24 A A 0.0000
25 S A -1.2524
26 G A -1.0108
27 F A -0.3797
28 T A -0.2056
29 F A 0.0000
30 S A -0.5206
31 S A -0.0757
32 Y A 0.1377
33 A A 0.0000
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6165
40 A A -1.0316
41 P A -0.8235
42 G A -1.4493
43 K A -2.2661
44 G A -1.4755
45 L A 0.0000
46 E A -0.9369
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 A A 0.0000
51 I A 0.0000
52 S A -0.0743
53 G A 0.0000
54 S A -0.6172
55 G A -0.6958
56 G A -0.6822
57 S A -0.3231
58 T A -0.0716
59 Y A -0.3136
60 Y A -0.9262
61 A A 0.0000
62 D A -2.4622
63 S A -1.7806
64 V A 0.0000
65 K A -2.5646
66 G A -1.8109
67 R A -1.7006
68 F A 0.0000
69 T A -0.9281
70 I A 0.0000
71 S A -0.4414
72 R A -0.9783
73 D A -1.4617
74 N A -1.6203
75 S A -1.5357
76 K A -2.3230
77 N A -1.6680
78 T A -1.2368
79 L A 0.0000
80 Y A -0.5067
81 L A 0.0000
82 Q A -1.4096
83 M A 0.0000
84 N A -2.0512
85 S A -1.5017
86 L A 0.0000
87 R A -2.3227
88 A A -1.7059
89 E A -2.2170
90 D A 0.0000
91 T A -0.3821
92 A A 0.0000
93 V A 0.7969
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 K A 0.0000
99 A A 0.0000
100 F A -0.0662
101 R A -0.4982
102 S A 0.1922
103 Y A 0.8658
104 Y A 0.0000
105 Y A 0.0693
106 D A -0.5174
107 S A -0.4870
108 S A -0.4889
109 G A -0.4165
110 Y A -0.0202
111 L A 0.0000
112 Q A 0.0000
113 P A 0.0000
114 F A 0.0000
115 D A 0.1473
116 Y A 0.4475
117 W A -0.1698
118 G A 0.0000
119 Q A -1.7805
120 G A -0.6497
121 T A 0.1732
122 L A 1.5441
123 V A 0.0000
124 T A 0.2811
125 V A 0.0000
126 S A -0.7745
127 S A -0.5507
1 Q B -0.8337
2 L B -0.0150
3 V B 1.2759
4 L B 0.0000
5 T B -0.0639
6 Q B -0.6682
7 S B -0.6561
8 P B -0.9258
9 S B -0.9340
10 V B -0.6126
11 S B -0.1344
12 V B -0.5547
13 A B -0.4438
14 P B -1.3619
15 G B -2.3290
16 K B -2.7205
17 T B -2.1601
18 A B 0.0000
19 R B -1.8542
20 I B 0.0000
21 T B -0.6401
22 C B 0.0000
23 G B -0.8816
24 G B -1.1234
25 N B -2.1763
26 N B -2.7702
27 I B 0.0000
28 G B -1.9419
29 S B -1.3374
30 K B -0.6682
31 S B -0.1050
32 V B 0.0000
33 H B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 H B -0.4777
37 Q B 0.0000
38 K B -1.5918
39 P B -1.3112
40 G B -1.4610
41 Q B -1.8046
42 A B -0.7913
43 P B 0.0000
44 V B 0.8623
45 L B 0.0000
46 V B 0.0000
47 I B 0.0000
48 Y B -0.5048
49 Y B -0.1726
50 D B -0.8995
51 S B -1.2445
52 D B -1.8950
53 R B -1.9822
54 P B -0.8537
55 S B -0.7601
56 G B -0.8351
57 I B -0.8545
58 P B -1.2882
59 E B -2.2154
60 R B -1.9081
61 F B 0.0000
62 S B -1.3966
63 G B -0.9962
64 S B -0.7518
65 N B -1.1523
66 S B -1.4073
67 G B -2.0417
68 N B -2.6616
69 T B -1.4943
70 A B 0.0000
71 T B -0.7880
72 L B 0.0000
73 T B -1.1294
74 I B 0.0000
75 S B -2.3799
76 R B -3.1294
77 V B 0.0000
78 E B -2.6623
79 A B -0.9930
80 G B -1.2025
81 D B 0.0000
82 E B -1.7462
83 A B 0.0000
84 D B -1.5102
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 Q B 0.0000
89 V B 0.0000
90 W B 0.0000
91 D B 0.0000
92 S B -0.6892
93 S B -0.7816
94 S B -1.0756
95 D B -0.9558
96 H B 0.0000
97 A B 0.0000
98 V B 0.1440
99 F B 0.0000
100 G B 0.0000
101 G B -0.8431
102 G B -1.1774
103 T B 0.0000
104 K B -1.9888
105 L B 0.0000
106 T B -0.3225
107 V B -0.0790
108 L B 1.3123
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018