Project name: GSGGSGSGGS

Chain sequence(s)	A: GSGGSGSGGSEVQLVESGGGLVQPGGSLRLSCAASLEHVAIGWFRQAPGKEREGVSCISSSGGHIHYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAAAVSYWECYDKLDYWGQGTLVTVSSPP
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:38)

• Minimal score value: -2.3386
• Maximal score value: 1.7728
• Average score: -0.3266
• Total score value: -42.7908

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-0.5060
2	S	A	-0.3882
3	G	A	-0.5939
4	G	A	-0.5922
5	S	A	-0.3826
6	G	A	-0.5439
7	S	A	-0.3824
8	G	A	-0.5912
9	G	A	-0.5913
10	S	A	-0.6293
11	E	A	-1.8256
12	V	A	-0.3636
13	Q	A	-1.1646
14	L	A	0.0000
15	V	A	1.7728
16	E	A	0.0000
17	S	A	-0.2026
18	G	A	-0.3481
19	G	A	-0.2721
20	G	A	0.0620
21	L	A	1.5103
22	V	A	0.0000
23	Q	A	-1.2227
24	P	A	-0.4348
25	G	A	-0.5252
26	G	A	-0.1646
27	S	A	-0.1685
28	L	A	-0.1236
29	R	A	-1.8533
30	L	A	0.0000
31	S	A	-0.0125
32	C	A	0.0000
33	A	A	0.0254
34	A	A	-0.0286
35	S	A	-0.0860
36	L	A	0.3301
37	E	A	-1.8492
38	H	A	-1.1990
39	V	A	0.0000
40	A	A	0.0000
41	I	A	0.0000
42	G	A	0.0000
43	W	A	0.0000
44	F	A	0.2068
45	R	A	0.0000
46	Q	A	-0.5357
47	A	A	-0.1069
48	P	A	-0.3370
49	G	A	-0.8143
50	K	A	-2.1210
51	E	A	-2.3386
52	R	A	-1.6985
53	E	A	-1.3789
54	G	A	-0.3031
55	V	A	0.0000
56	S	A	0.0000
57	C	A	0.0000
58	I	A	0.0000
59	S	A	0.0000
60	S	A	0.0000
61	S	A	-0.2388
62	G	A	-0.2653
63	G	A	-0.6706
64	H	A	-0.8952
65	I	A	0.6463
66	H	A	-0.5744
67	Y	A	0.1357
68	A	A	-0.2596
69	D	A	-1.8178
70	S	A	-0.4919
71	V	A	0.0000
72	K	A	-1.7844
73	G	A	-0.8304
74	R	A	-0.4013
75	F	A	0.0000
76	T	A	-0.0453
77	I	A	0.0000
78	S	A	-0.1636
79	R	A	-0.4064
80	D	A	-0.8087
81	N	A	-1.4297
82	S	A	-0.7468
83	K	A	-1.7759
84	N	A	-0.6560
85	T	A	0.0000
86	V	A	0.0000
87	Y	A	0.1475
88	L	A	0.0000
89	Q	A	-0.6457
90	M	A	0.0000
91	N	A	-0.5422
92	S	A	-0.3194
93	L	A	0.0000
94	R	A	-1.1312
95	A	A	-0.4721
96	E	A	-1.8095
97	D	A	0.0000
98	T	A	-0.0181
99	A	A	0.0000
100	V	A	0.5577
101	Y	A	0.0000
102	Y	A	0.2069
103	C	A	0.0000
104	A	A	0.0000
105	A	A	0.0000
106	A	A	0.0000
107	V	A	1.6031
108	S	A	0.3639
109	Y	A	0.9393
110	W	A	1.0845
111	E	A	-1.0639
112	C	A	-0.0632
113	Y	A	0.2582
114	D	A	-1.6736
115	K	A	-1.9237
116	L	A	-0.4401
117	D	A	-1.6921
118	Y	A	0.0906
119	W	A	0.4655
120	G	A	-0.1983
121	Q	A	-1.2086
122	G	A	0.0000
123	T	A	0.2745
124	L	A	1.5934
125	V	A	0.0000
126	T	A	0.1585
127	V	A	0.0000
128	S	A	-0.1580
129	S	A	-0.2812
130	P	A	-0.3400
131	P	A	-0.3012