Project name: a75a78570ecf8fe [mutate: RS88A]

Status: done

Started: 2025-07-18 02:54:26
Settings
Chain sequence(s) A: GRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues RS88A
Energy difference between WT (input) and mutated protein (by FoldX) 1.28746 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:22)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:28)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)
Show buried residues

Minimal score value
-3.3878
Maximal score value
2.3577
Average score
-0.6437
Total score value
-90.7618

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.9329
2 R A -1.2059
3 F A 0.3776
4 G A -0.5276
5 G A -1.1742
6 N A -1.6886
7 P A -1.1999
8 G A -0.7249
9 G A -0.2771
10 F A 0.9198
11 G A -0.7564
12 N A -1.9362
13 Q A -1.8497
14 G A -1.2180
15 G A -0.5342
16 F A 0.8664
17 G A -0.7041
18 N A -1.8334
19 S A -1.7750
20 R A -2.8147
21 G A -1.9931
22 G A -1.4403
23 G A -0.9688
24 A A -0.2346
25 G A -0.2349
26 L A 0.5112
27 G A -1.0641
28 N A -2.1746
29 N A -2.7379
30 Q A -2.7060
31 G A -1.9537
32 S A -1.2787
33 N A -1.5297
34 M A -0.0126
35 G A -0.4885
36 G A -0.6976
37 G A -0.3977
38 M A 0.5538
39 N A 0.1386
40 F A 2.0596
41 G A 0.9169
42 A A 1.3174
43 F A 2.3577
44 S A 1.1943
45 I A 1.7567
46 N A -0.0199
47 P A 0.0729
48 A A 0.2575
49 M A 0.8282
50 M A 0.9270
51 A A 0.2017
52 A A 0.1096
53 A A 0.0046
54 Q A -0.8874
55 A A -0.5317
56 A A -0.1745
57 L A -0.1568
58 Q A -0.9525
59 S A -0.3064
60 S A 0.3046
61 W A 1.2161
62 G A 0.5006
63 M A 1.2445
64 M A 1.7661
65 G A 0.8514
66 M A 1.0776
67 L A 1.0964
68 A A -0.2365
69 S A -1.0343
70 Q A -1.9573
71 Q A -2.5006
72 N A -2.8311
73 Q A -2.9039
74 S A -2.1641
75 G A -1.6846
76 P A -1.1558
77 S A -1.4447
78 G A -1.9443
79 N A -2.7748
80 N A -3.2505
81 Q A -3.3482
82 N A -3.3878
83 Q A -2.8112
84 G A -2.1118
85 N A -1.8374
86 M A -0.7387
87 Q A -1.6697
88 S A -1.7952 mutated: RS88A
89 E A -2.7577
90 P A -2.2338
91 N A -2.2928
92 Q A -1.6074
93 A A -0.1154
94 F A 1.1249
95 G A -0.1178
96 S A -0.7835
97 G A -1.4961
98 N A -2.1460
99 N A -1.7968
100 S A -0.7449
101 Y A 0.3302
102 S A -0.1226
103 G A -0.3680
104 S A -0.9028
105 N A -1.5693
106 S A -1.1235
107 G A -0.7397
108 A A 0.0995
109 A A 0.7435
110 I A 2.0219
111 G A 0.9536
112 W A 1.2324
113 G A 0.1329
114 S A -0.4008
115 A A -0.4721
116 S A -0.9809
117 N A -1.4723
118 A A -0.9341
119 G A -0.9979
120 S A -0.7053
121 G A -0.6713
122 S A -0.5052
123 G A -0.0162
124 F A 0.8588
125 N A -0.4902
126 G A -0.1882
127 G A 0.1084
128 F A 1.1965
129 G A 0.2933
130 S A -0.0149
131 S A -0.2648
132 M A -0.3430
133 D A -1.9856
134 S A -1.7306
135 K A -2.4102
136 S A -1.4320
137 S A -0.8020
138 G A -0.2961
139 W A 0.9006
140 G A 0.4675
141 M A 1.0545
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018