Project name: guiyu

Chain sequence(s)	A: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:29)

• Minimal score value: -2.2574
• Maximal score value: 2.0466
• Average score: -0.4447
• Total score value: -14.2306

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	C	A	0.7644
2	S	A	-0.1559
3	N	A	-0.0979
4	L	A	1.5692
5	S	A	1.1204
6	T	A	0.9815
7	C	A	1.3621
8	V	A	2.0466
9	L	A	1.8020
10	G	A	0.4418
11	K	A	-0.9505
12	L	A	0.2132
13	S	A	-0.4592
14	Q	A	-2.0329
15	E	A	-2.1814
16	L	A	-0.4333
17	H	A	-1.7677
18	K	A	-1.5260
19	L	A	-0.2745
20	Q	A	-1.2335
21	T	A	-0.7283
22	Y	A	0.3064
23	P	A	-0.9631
24	R	A	-2.1654
25	T	A	-1.5547
26	N	A	-2.2574
27	T	A	-1.4272
28	G	A	-1.4404
29	S	A	-0.9618
30	G	A	-1.0315
31	T	A	-0.7310
32	P	A	-0.4646