Project name: 8f71719f928f532

Status: done

Started: 2024-12-20 12:05:58
Settings
Chain sequence(s) A: QSALTQPPSASGSPGQSVTISCTGTSSDVGGSDSVSWYQQHPGKAPKLIIYEVSQRPSGVPNRFSGSKSGNTASLTVSGLQAEDDADYYCSSYNLFFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:28)
Show buried residues

Minimal score value
-3.2071
Maximal score value
2.021
Average score
-0.7956
Total score value
-167.0659

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4823
2 S A -0.3397
3 A A 0.3001
4 L A 0.0000
5 T A -0.2235
6 Q A 0.0000
7 P A -0.4798
8 P A -0.6105
9 S A -0.5824
11 A A -0.3863
12 S A -0.5555
13 G A 0.0000
14 S A -0.8109
15 P A -1.1507
16 G A -1.4559
17 Q A -1.7004
18 S A -1.0555
19 V A 0.0000
20 T A -0.1909
21 I A 0.0000
22 S A -0.2450
23 C A 0.0000
24 T A -0.5018
25 G A -0.3764
26 T A -0.7581
27 S A -0.9706
28 S A -0.5877
29 D A -0.6513
30 V A 0.0000
31 G A -1.5724
35 G A -1.3962
36 S A -1.5222
37 D A -2.5776
38 S A -1.3163
39 V A 0.0000
40 S A 0.0000
41 W A 0.0000
42 Y A -0.0753
43 Q A 0.0000
44 Q A -1.5511
45 H A -1.8926
46 P A -1.3766
47 G A -1.5342
48 K A -2.3571
49 A A -1.3546
50 P A -1.3385
51 K A -1.3215
52 L A 0.0503
53 I A 0.0000
54 I A 0.0000
55 Y A -1.2519
56 E A -2.7103
57 V A 0.0000
65 S A -1.7535
66 Q A -2.1172
67 R A -1.7527
68 P A -0.8188
69 S A -0.6593
70 G A -0.7838
71 V A -0.9053
72 P A -1.0848
74 N A -1.8090
75 R A -1.1179
76 F A 0.0000
77 S A -0.9604
78 G A 0.0000
79 S A -1.0619
80 K A -1.3855
83 S A -0.8966
84 G A -1.1993
85 N A -1.4271
86 T A -0.8467
87 A A 0.0000
88 S A -0.3486
89 L A 0.0000
90 T A -0.2969
91 V A 0.0000
92 S A -1.1455
93 G A -1.2280
94 L A 0.0000
95 Q A -1.8597
96 A A -1.4684
97 E A -2.2471
98 D A 0.0000
99 D A -1.4873
100 A A 0.0000
101 D A -1.0670
102 Y A 0.0000
103 Y A 0.3513
104 C A 0.0000
105 S A 0.0000
106 S A 0.0000
107 Y A 1.0044
115 N A -0.3702
116 L A 1.2807
117 F A 1.6204
118 F A 2.0210
119 G A 0.0000
120 G A -0.3987
121 G A -0.2652
122 T A 0.0000
123 K A -0.8518
124 V A 0.0000
125 T A 0.0000
126 V A -0.7181
127 L A -0.3725
128 G A -0.6493
129 Q A -1.0006
130 P A -1.1035
131 K A -1.7706
132 A A -1.0798
133 A A -0.5533
134 P A -0.4115
135 S A -0.2028
136 V A 0.0000
137 T A 0.1684
138 L A 0.0000
139 F A 1.3702
140 P A 0.5102
141 P A -0.4703
142 S A -1.1175
143 S A -1.7198
144 E A -2.9471
145 E A -2.7629
146 L A -2.3238
147 Q A -2.6323
148 A A -2.2627
149 N A -2.9766
150 K A -3.1780
151 A A 0.0000
152 T A -0.4444
153 L A 0.0000
154 V A 1.0871
155 C A 0.0000
156 L A 0.9493
157 I A 0.0000
158 S A -0.7352
159 D A -2.0201
160 F A 0.0000
161 Y A 0.0000
162 P A 0.0000
163 G A -0.7120
164 A A -0.1413
165 V A 0.0711
166 T A 0.0939
167 V A 0.0003
168 A A -0.3504
169 W A 0.0000
170 K A -1.0607
171 A A -1.1111
172 D A -1.3558
173 S A -0.8484
174 S A -0.5296
175 P A -0.7474
176 V A -0.6073
177 K A -1.5889
178 A A -0.8469
179 G A -0.6590
180 V A -0.4778
181 E A -1.3894
182 T A -0.5111
183 T A -0.4943
184 T A -0.1312
185 P A -0.5861
186 S A -1.3462
187 K A -2.8591
188 Q A -2.7736
189 S A -2.1208
190 N A -2.7420
191 N A -3.0295
192 K A -2.7010
193 Y A -1.7541
194 A A -0.9480
195 A A 0.0000
196 S A 0.1053
197 S A 0.0000
198 Y A 0.3682
199 L A 0.0000
200 S A -0.6820
201 L A 0.0000
202 T A -2.0089
203 P A -2.6571
204 E A -3.2071
205 Q A -2.2470
206 W A 0.0000
207 K A -3.0403
208 S A -2.3265
209 H A -2.3246
210 R A -2.4858
211 S A -1.4843
212 Y A 0.0000
213 S A 0.0000
214 C A 0.0000
215 Q A -0.9294
216 V A 0.0000
217 T A -0.3780
218 H A 0.0000
219 E A -1.0685
220 G A -0.8759
221 S A -0.5114
222 T A -0.5005
223 V A -0.5695
224 E A -1.9849
225 K A -1.3404
226 T A -0.7134
227 V A -0.0886
228 A A -0.8601
229 P A -1.3285
230 T A -1.1849
231 E A -1.8670
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018