Project name: A?42 [mutate: FL19A, FL20A] [mutate: LA19A, LA20A]

Chain sequence(s)	A: DAEFRHDSGYEVHHQKLVLLAEDVGSNKGAIIGLMVGGVVIA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LA20A,LA19A
Energy difference between WT (input) and mutated protein (by FoldX)	1.04592 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:11)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:13)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:26)

• Minimal score value: -3.0352
• Maximal score value: 3.856
• Average score: -0.1477
• Total score value: -6.2014

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	D	A	-2.7194
2	A	A	-2.4178
3	E	A	-2.5496
4	F	A	-0.9645
5	R	A	-2.7335
6	H	A	-3.0352
7	D	A	-2.5501
8	S	A	-1.2960
9	G	A	-0.5579
10	Y	A	-0.1686
11	E	A	-0.9670
12	V	A	0.5090
13	H	A	-1.0270
14	H	A	-1.2803
15	Q	A	-1.3988
16	K	A	-1.5478
17	L	A	-0.4463
18	V	A	-0.9574
19	A	A	-0.8495	mutated: LA19A
20	A	A	-0.5796	mutated: LA20A
21	A	A	-0.6467
22	E	A	-1.9968
23	D	A	-2.1816
24	V	A	-0.7760
25	G	A	-1.3285
26	S	A	-1.7156
27	N	A	-2.0365
28	K	A	-1.6433
29	G	A	-0.1713
30	A	A	0.3509
31	I	A	2.3685
32	I	A	3.2225
33	G	A	2.3451
34	L	A	3.0691
35	M	A	3.4472
36	V	A	2.9578
37	G	A	1.9952
38	G	A	1.8605
39	V	A	3.0341
40	V	A	3.8560
41	I	A	3.4891
42	A	A	1.8362