Project name: 8fcf7f4b9764312

Chain sequence(s)	A: DFMLTQPHSVSESPGKTVTISCTRSSGILASNSVQWFQQRPGSSPTTVIYGGIQRPSGVPDRFSGSFDSSSNSASLSISGLKTEDEADYYCQSYDSTNEGVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)

• Minimal score value: -2.4265
• Maximal score value: 1.5454
• Average score: -0.3959
• Total score value: -43.9496

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	D	A	-2.0725
2	F	A	0.0000
3	M	A	0.6529
4	L	A	0.0000
5	T	A	-0.0200
6	Q	A	-0.4280
7	P	A	-0.8147
8	H	A	-1.4048
9	S	A	-0.9113
10	V	A	-0.4252
11	S	A	-0.1373
12	E	A	-0.6022
13	S	A	-0.4787
14	P	A	-1.0051
15	G	A	-1.6760
16	K	A	-2.0352
17	T	A	-1.2467
18	V	A	0.0000
19	T	A	-0.1990
20	I	A	0.0000
21	S	A	0.0250
22	C	A	0.0000
23	T	A	-0.1471
24	R	A	0.0676
25	S	A	-0.1811
26	S	A	-0.2751
27	G	A	-0.0240
28	I	A	1.0949
29	L	A	0.0000
30	A	A	0.4348
31	S	A	0.2409
32	N	A	-0.0412
33	S	A	0.2328
34	V	A	0.0000
35	Q	A	0.1780
36	W	A	0.0000
37	F	A	-0.1361
38	Q	A	0.0000
39	Q	A	-1.5438
40	R	A	-2.3396
41	P	A	-1.4483
42	G	A	-1.0610
43	S	A	-1.0385
44	S	A	-0.7863
45	P	A	-0.7666
46	T	A	-0.3632
47	T	A	-0.0393
48	V	A	0.0000
49	I	A	0.0000
50	Y	A	0.2443
51	G	A	-0.0890
52	G	A	0.7354
53	I	A	1.4476
54	Q	A	-0.5376
55	R	A	-1.1106
56	P	A	-0.8935
57	S	A	-0.8935
58	G	A	-0.8407
59	V	A	-0.7782
60	P	A	-1.2555
61	D	A	-2.1909
62	R	A	-1.2959
63	F	A	0.0000
64	S	A	-0.3537
65	G	A	0.0000
66	S	A	0.8272
67	F	A	1.4102
68	D	A	-0.3001
69	S	A	-0.1457
70	S	A	-0.3652
71	S	A	-0.3669
72	N	A	-0.1610
73	S	A	-0.0262
74	A	A	0.0000
75	S	A	0.2751
76	L	A	0.0000
77	S	A	-0.2773
78	I	A	0.0000
79	S	A	-1.2720
80	G	A	-1.5034
81	L	A	0.0000
82	K	A	-2.1764
83	T	A	-1.4925
84	E	A	-2.4265
85	D	A	0.0000
86	E	A	-1.9869
87	A	A	0.0000
88	D	A	-1.6805
89	Y	A	0.0000
90	Y	A	0.0880
91	C	A	0.0000
92	Q	A	0.7274
93	S	A	0.0000
94	Y	A	0.5368
95	D	A	0.0000
96	S	A	-0.8245
97	T	A	-1.0459
98	N	A	-1.9128
99	E	A	-1.7963
100	G	A	-0.3344
101	V	A	0.4767
102	F	A	1.5454
103	G	A	0.6455
104	G	A	-0.3424
105	G	A	-0.6071
106	T	A	0.0000
107	K	A	-1.4640
108	L	A	0.0000
109	T	A	-0.3388
110	V	A	-0.2413
111	L	A	1.1390