Project name: KAP2

Status: done

Started: 2026-07-08 19:05:04
Settings
Chain sequence(s) A: EPTSCQTSYVESSPCQTSCYRPRTSLLCSPCQTTYSGSLGFGSSSCRSLGYGSRSCYVGCGSSGFRSLGYGGCGFPSLSYGSRFCRPTYLASRS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:26)
Show buried residues

Minimal score value
-2.05
Maximal score value
2.352
Average score
0.2151
Total score value
20.2165

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.9860
2 P A -1.1335
3 T A -0.7029
4 S A -0.5121
5 C A -0.0555
6 Q A -0.8368
7 T A -0.0686
8 S A 0.2853
9 Y A 1.1505
10 V A 1.0194
11 E A -1.0261
12 S A -0.4952
13 S A -0.8755
14 P A -0.9402
15 C A -0.1925
16 Q A -1.0046
17 T A 0.1241
18 S A 0.7266
19 C A 1.2117
20 Y A 1.1651
21 R A -0.7819
22 P A -1.2620
23 R A -2.0500
24 T A -0.9085
25 S A 0.2535
26 L A 1.7392
27 L A 2.3161
28 C A 1.5091
29 S A 0.3548
30 P A -0.4260
31 C A -0.2585
32 Q A -1.0301
33 T A -0.1987
34 T A 0.1121
35 Y A 0.9619
36 S A 0.4367
37 G A 0.0458
38 S A 0.4943
39 L A 1.4262
40 G A 0.9086
41 F A 1.7023
42 G A 0.3419
43 S A 0.4526
44 S A 0.2837
45 S A -0.1009
46 C A -0.1969
47 R A -1.5899
48 S A -0.5995
49 L A 0.8041
50 G A 0.3111
51 Y A 0.8729
52 G A -0.3187
53 S A -0.9658
54 R A -1.7994
55 S A -0.6473
56 C A 0.5488
57 Y A 1.9940
58 V A 2.3520
59 G A 1.2792
60 C A 0.9734
61 G A -0.2365
62 S A -0.4588
63 S A -0.5558
64 G A -0.3448
65 F A 0.8518
66 R A -0.7068
67 S A 0.2612
68 L A 1.5267
69 G A 0.6177
70 Y A 1.5115
71 G A 1.1488
72 G A 1.0706
73 C A 1.4868
74 G A 1.1161
75 F A 2.2530
76 P A 1.0946
77 S A 1.1033
78 L A 1.8279
79 S A 0.6433
80 Y A 1.1206
81 G A 0.0216
82 S A -0.1486
83 R A -0.9724
84 F A 0.7864
85 C A 0.1736
86 R A -0.9906
87 P A 0.0355
88 T A 0.5213
89 Y A 1.7060
90 L A 1.6425
91 A A 0.4534
92 S A -0.5424
93 R A -1.8396
94 S A -1.1548
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018