Project name: obj1 [mutate: QE3C, EP6C, GV9C, SR119C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	QE3C,GV9C,EP6C,SR119C
Energy difference between WT (input) and mutated protein (by FoldX)	11.7042 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:47)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:11)

• Minimal score value: -3.3333
• Maximal score value: 1.9343
• Average score: -0.6771
• Total score value: -81.2482

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.1560
2	V	C	-1.2479
3	E	C	-1.7480	mutated: QE3C
4	L	C	0.0000
5	V	C	1.0524
6	P	C	0.7197	mutated: EP6C
7	S	C	-0.0656
8	G	C	-0.4898
9	V	C	0.6252	mutated: GV9C
10	G	C	1.2109
11	L	C	1.2549
12	V	C	-0.3312
13	Q	C	-1.8816
14	P	C	-1.8912
15	G	C	-1.4142
16	G	C	-0.9782
17	S	C	-1.2276
18	L	C	-0.8204
19	R	C	-2.0248
20	L	C	0.0000
21	S	C	-0.3274
22	C	C	0.0000
23	A	C	-0.0662
24	A	C	0.0000
25	S	C	-0.3241
26	D	C	0.0000
27	F	C	1.5440
28	T	C	0.2504
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1454
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.3208
40	A	C	-0.9994
41	P	C	-1.3040
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3867
46	E	C	-0.3909
47	W	C	0.3405
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6465
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6524
81	L	C	0.0000
82	Q	C	-1.2315
83	M	C	0.0000
84	N	C	-1.3306
85	S	C	-1.2311
86	L	C	0.0000
87	R	C	-2.7409
88	A	C	-2.3836
89	E	C	-2.5423
90	D	C	0.0000
91	T	C	-0.6919
92	A	C	0.0000
93	I	C	1.0900
94	Y	C	0.0000
95	Y	C	0.7328
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1907
101	D	C	-3.3333
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1848
106	G	C	-1.9076
107	F	C	-0.9859
108	D	C	-1.1036
109	Y	C	-0.3386
110	W	C	0.5323
111	G	C	0.0091
112	Q	C	-0.7883
113	G	C	0.2947
114	T	C	0.8444
115	L	C	1.9343
116	V	C	0.0000
117	T	C	0.0173
118	V	C	0.0000
119	R	C	-2.4695	mutated: SR119C
120	S	C	-1.8709