Project name: 90a6dcb85af87d8

Status: done

Started: 2026-06-22 16:06:51
Settings
Chain sequence(s) B: LMDEIMKLTEEIKKAMEEAYKLLQEDPEKAEEELKKVKELSAELQKLFDA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:33)
Show buried residues

Minimal score value
-4.6695
Maximal score value
1.347
Average score
-2.2552
Total score value
-112.759

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L B 1.3470
2 M B 0.6518
3 D B -1.5096
4 E B -1.7065
5 I B -0.4679
6 M B -0.7742
7 K B -2.7471
8 L B -2.2132
9 T B -2.2049
10 E B -3.6325
11 E B -3.3005
12 I B -3.0712
13 K B -3.9539
14 K B -3.8512
15 A B 0.0000
16 M B -2.3242
17 E B -2.7110
18 E B -2.7298
19 A B 0.0000
20 Y B -0.6564
21 K B -2.2312
22 L B -2.6100
23 L B -1.3178
24 Q B -1.8321
25 E B -2.9178
26 D B -2.7678
27 P B -2.7561
28 E B -3.8945
29 K B -4.4813
30 A B 0.0000
31 E B -3.9417
32 E B -4.6695
33 E B -3.6722
34 L B -2.8636
35 K B -4.0259
36 K B -3.4534
37 V B -3.3456
38 K B -3.5164
39 E B -3.6147
40 L B -2.8509
41 S B -2.3449
42 A B -2.2894
43 E B -2.5754
44 L B -1.7306
45 Q B -2.1216
46 K B -2.4967
47 L B -0.5761
48 F B 0.3444
49 D B -1.7799
50 A B -0.5710
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018