Project name: 914905850e1d161

Status: done

Started: 2026-06-26 11:01:34
Settings
Chain sequence(s) A: MSHHHHHHSGAKNIFHWFFEESSKLSDEELEKLLRSFAGDLQNAFLVYLDSDEEGKKHAYLILVDMLEDMMKIIAEATGKDVEEMLKGVEKLKEESEGDPIKLLELFFEEVLKGMEEFPDAKIMELLKKGKPMAGLSYEEQLKWLKEFAERLIKLLKESEKLSEEEKEKLKEEFDKLLGEFMGNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:06:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:00)
Show buried residues

Minimal score value
-5.2094
Maximal score value
0.5551
Average score
-1.8156
Total score value
-335.8869

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5551
2 S A -0.6182
3 H A -1.7533
4 H A -2.3468
5 H A -2.7666
6 H A -2.7751
7 H A -2.5733
8 H A -2.1950
9 S A -1.6854
10 G A -1.5233
11 A A -1.5323
12 K A -2.1548
13 N A -1.7528
14 I A 0.0000
15 F A 0.0000
16 H A -1.6534
17 W A 0.0000
18 F A 0.0000
19 F A 0.0000
20 E A -2.8004
21 E A -2.1329
22 S A 0.0000
23 S A -1.6218
24 K A -2.3737
25 L A 0.0000
26 S A -2.4946
27 D A -3.5847
28 E A -3.8178
29 E A -3.4055
30 L A 0.0000
31 E A -3.8408
32 K A -3.6585
33 L A 0.0000
34 L A -1.8164
35 R A -2.7642
36 S A -2.0230
37 F A 0.0000
38 A A 0.0000
39 G A -1.1667
40 D A -1.4165
41 L A 0.0000
42 Q A -1.0138
43 N A -0.9089
44 A A 0.0000
45 F A 0.0000
46 L A -0.6313
47 V A -1.0574
48 Y A 0.0000
49 L A 0.0000
50 D A -2.7528
51 S A -3.1293
52 D A -4.2050
53 E A -4.2393
54 E A -4.2474
55 G A 0.0000
56 K A -3.3317
57 K A -3.0866
58 H A -1.6249
59 A A 0.0000
60 Y A -1.1700
61 L A -0.1149
62 I A -0.4705
63 L A 0.0000
64 V A 0.0000
65 D A -1.9266
66 M A 0.0000
67 L A 0.0000
68 E A -2.0183
69 D A -1.9923
70 M A 0.0000
71 M A 0.0000
72 K A -1.9954
73 I A -1.4309
74 I A 0.0000
75 A A 0.0000
76 E A -2.5016
77 A A -1.7025
78 T A 0.0000
79 G A -1.9735
80 K A -2.7995
81 D A -3.4754
82 V A -2.7563
83 E A -3.5030
84 E A -3.8221
85 M A 0.0000
86 L A -2.7737
87 K A -3.4489
88 G A -2.6677
89 V A 0.0000
90 E A -3.7953
91 K A -3.5671
92 L A 0.0000
93 K A -3.7005
94 E A -4.3765
95 E A -4.1841
96 S A 0.0000
97 E A -3.5678
98 G A -2.5965
99 D A -2.5171
100 P A 0.0000
101 I A 0.0000
102 K A -2.4654
103 L A 0.0000
104 L A 0.0000
105 E A -2.6009
106 L A -1.6492
107 F A 0.0000
108 F A 0.0000
109 E A -2.1851
110 E A -1.8758
111 V A -1.2521
112 L A -2.0363
113 K A -2.9714
114 G A 0.0000
115 M A 0.0000
116 E A -3.4495
117 E A -3.3067
118 F A -2.5045
119 P A -2.4450
120 D A -2.8035
121 A A 0.0000
122 K A -2.2380
123 I A 0.0000
124 M A 0.0000
125 E A -2.7822
126 L A -2.1191
127 L A -1.6441
128 K A -2.4404
129 K A -2.8545
130 G A -2.3769
131 K A -2.7687
132 P A -1.6029
133 M A 0.0000
134 A A -1.8879
135 G A -1.4177
136 L A -1.5732
137 S A -1.5425
138 Y A -2.1725
139 E A -3.0881
140 E A -3.0258
141 Q A 0.0000
142 L A 0.0000
143 K A -3.3310
144 W A -2.3223
145 L A 0.0000
146 K A -3.1262
147 E A -3.5776
148 F A 0.0000
149 A A 0.0000
150 E A -4.0235
151 R A -3.7396
152 L A 0.0000
153 I A 0.0000
154 K A -3.5932
155 L A 0.0000
156 L A 0.0000
157 K A -3.4682
158 E A -3.8873
159 S A 0.0000
160 E A -3.7269
161 K A -3.5217
162 L A -3.2471
163 S A -2.8013
164 E A -4.3359
165 E A -4.3431
166 E A -4.3773
167 K A -4.9498
168 E A -5.2094
169 K A -4.9452
170 L A 0.0000
171 K A -3.7532
172 E A -4.5128
173 E A -3.9266
174 F A 0.0000
175 D A -3.2866
176 K A -3.5456
177 L A 0.0000
178 L A 0.0000
179 G A -2.1050
180 E A -2.1626
181 F A -0.9795
182 M A -1.2471
183 G A -1.9867
184 N A -2.1445
185 S A -1.8611
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018