Project name: 91496d640c31ba1

Status: done

Started: 2026-06-23 15:04:58
Settings
Chain sequence(s) A: MSHHHHHHSGSPEEELERLLKEIREQREEILEKIKKLSEGEEVDPEEIWDKLWEFFKKIDRALMIRVMTSDDIEAERERMRELHRAWSEAMHAFLNLRFADEPNPEYYERIKEALERALRAVDPSLVNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:47)
Show buried residues

Minimal score value
-4.2097
Maximal score value
0.8223
Average score
-1.8806
Total score value
-242.5943

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5510
2 S A -0.6434
3 H A -1.7367
4 H A -2.3619
5 H A -2.7348
6 H A -2.7698
7 H A -2.5355
8 H A -2.3800
9 S A -1.4104
10 G A -1.5780
11 S A -1.5816
12 P A -1.8455
13 E A -3.0435
14 E A -2.9687
15 E A -2.5640
16 L A -2.5347
17 E A -3.3852
18 R A -3.2614
19 L A 0.0000
20 L A -2.5014
21 K A -3.6196
22 E A -3.5920
23 I A 0.0000
24 R A -3.2764
25 E A -4.1647
26 Q A -3.6140
27 R A -3.1869
28 E A -4.1732
29 E A -4.2097
30 I A 0.0000
31 L A -2.8212
32 E A -3.5810
33 K A -3.6054
34 I A 0.0000
35 K A -3.1893
36 K A -3.3629
37 L A -3.0227
38 S A 0.0000
39 E A -3.6371
40 G A -3.3009
41 E A -4.0133
42 E A -3.4973
43 V A -3.0689
44 D A -3.5502
45 P A -2.7220
46 E A -3.7431
47 E A -3.8105
48 I A 0.0000
49 W A -2.1350
50 D A -3.0112
51 K A -2.6597
52 L A 0.0000
53 W A -1.2866
54 E A -2.4743
55 F A 0.0000
56 F A 0.0000
57 K A -2.5502
58 K A -2.1557
59 I A 0.0000
60 D A -2.0300
61 R A -1.6155
62 A A 0.0000
63 L A 0.0000
64 M A 0.0485
65 I A 0.0000
66 R A -0.6300
67 V A -0.2710
68 M A 0.8223
69 T A -0.3376
70 S A -1.1818
71 D A -2.5104
72 D A -2.8669
73 I A -1.8204
74 E A -3.2170
75 A A -2.5812
76 E A 0.0000
77 R A -3.7111
78 E A -4.0327
79 R A -3.5358
80 M A -3.0931
81 R A -4.0351
82 E A -3.4632
83 L A 0.0000
84 H A -3.0581
85 R A -3.1861
86 A A 0.0000
87 W A -1.6193
88 S A -1.4518
89 E A -1.8950
90 A A 0.0000
91 M A 0.0000
92 H A -1.3807
93 A A 0.0000
94 F A 0.0000
95 L A -0.0812
96 N A -0.9455
97 L A 0.0000
98 R A -0.9168
99 F A 0.5159
100 A A -1.0967
101 D A -2.4860
102 E A -2.9748
103 P A -2.7287
104 N A -2.5642
105 P A -2.4982
106 E A -2.8494
107 Y A -2.5183
108 Y A -2.8546
109 E A -3.7156
110 R A -3.4305
111 I A 0.0000
112 K A -3.0577
113 E A -3.2979
114 A A 0.0000
115 L A 0.0000
116 E A -2.0430
117 R A -2.3625
118 A A 0.0000
119 L A 0.0000
120 R A -2.3845
121 A A 0.0000
122 V A 0.0000
123 D A -1.1889
124 P A -1.4673
125 S A -1.0711
126 L A 0.0000
127 V A -1.2352
128 N A -1.5660
129 S A -0.8021
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018