Project name: 22-6.pdb

Status: done

Started: 2026-03-19 06:05:09
Settings
Chain sequence(s) H: QVQLVESGGGLVQPGGSLRLSCAASGSISSHNDMSWYREALGNQLELVSFIASGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCNSRTYDGEKTYWGQGTTVTVSS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-2.7776
Maximal score value
1.2101
Average score
-0.6879
Total score value
-80.4847

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q H -1.5971
2 V H -1.1404
3 Q H -1.0750
4 L H 0.0000
5 V H 1.2101
6 E H 0.0000
7 S H -0.3217
8 G H -1.0048
9 G H -0.4087
11 G H 0.2750
12 L H 1.2008
13 V H -0.0526
14 Q H -1.4304
15 P H -1.7841
16 G H -1.5697
17 G H -1.0427
18 S H -1.0698
19 L H -0.8438
20 R H -1.9857
21 L H 0.0000
22 S H -0.2186
23 C H 0.0000
24 A H 0.0058
25 A H -0.3684
26 S H -0.6418
27 G H -0.7972
28 S H -0.8447
29 I H 0.0000
30 S H -1.4062
35 S H -1.1667
36 H H -1.3305
37 N H -1.1749
38 D H -0.9042
39 M H 0.0000
40 S H 0.0000
41 W H 0.0000
42 Y H 0.5545
43 R H 0.0000
44 E H -0.7608
45 A H -0.6278
46 L H 0.6713
47 G H -0.6534
48 N H -1.7051
49 Q H -1.5956
50 L H -0.2437
51 E H -0.4705
52 L H 0.8097
53 V H 0.0000
54 S H 0.0000
55 F H 0.8436
56 I H 0.0000
57 A H -0.6842
58 S H -1.2695
59 G H -1.0523
63 G H -0.6865
64 S H -0.2496
65 T H 0.4221
66 Y H 1.0763
67 Y H 0.0821
68 A H -0.7549
69 D H -2.2958
70 S H -1.9510
71 V H 0.0000
72 K H -2.3909
74 G H -1.7232
75 R H -1.6975
76 F H 0.0000
77 T H -0.5658
78 I H 0.0000
79 S H -0.4337
80 R H -1.2496
81 D H -1.9153
82 N H -2.3695
83 S H -1.8939
84 K H -2.5643
85 N H -2.0476
86 T H -1.0719
87 L H 0.0000
88 Y H -0.3021
89 L H 0.0000
90 Q H -1.0386
91 M H 0.0000
92 N H -1.3959
93 S H -1.3810
94 L H 0.0000
95 R H -2.7776
96 A H -1.9120
97 E H -2.3944
98 D H 0.0000
99 T H -0.4969
100 A H 0.0000
101 V H 0.4001
102 Y H 0.0000
103 Y H 0.4545
104 C H 0.0000
105 N H 0.0000
106 S H 0.0000
107 R H -1.3855
108 T H -1.5033
109 Y H -1.0659
110 D H -2.0883
113 G H -2.1512
114 E H -2.7324
115 K H -2.5170
116 T H -1.1004
117 Y H -0.6918
118 W H 0.1923
119 G H 0.0001
120 Q H -0.7587
121 G H -0.1624
122 T H -0.0884
123 T H -0.0160
124 V H 0.0000
125 T H -0.0366
126 V H 0.0000
127 S H -0.8554
128 S H -0.7276
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018