Project name: 9199f1314d65490

Chain sequence(s)	A: PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -3.5052
• Maximal score value: 3.5753
• Average score: -0.6292
• Total score value: -47.1905

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	P	A	-0.4839
2	E	A	-0.8044
3	L	A	1.1535
4	L	A	1.4407
5	G	A	0.1893
6	G	A	0.1714
7	P	A	0.0877
8	S	A	0.7470
9	V	A	2.7473
10	F	A	3.5753
11	L	A	3.5157
12	F	A	2.2381
13	P	A	0.1708
14	P	A	-1.3133
15	K	A	-2.3820
16	P	A	-1.5883
17	K	A	-1.8124
18	D	A	-1.4279
19	T	A	-0.4224
20	L	A	1.1494
21	M	A	1.3276
22	I	A	1.9647
23	S	A	0.5750
24	R	A	-0.6485
25	T	A	-0.8795
26	P	A	-1.3429
27	E	A	-1.5296
28	V	A	0.2802
29	T	A	0.7855
30	C	A	1.9749
31	V	A	0.0000
32	V	A	0.0000
33	V	A	-0.0635
34	D	A	-1.2979
35	V	A	0.0000
36	S	A	-2.3641
37	H	A	-3.0433
38	E	A	-3.4430
39	D	A	-3.5052
40	P	A	-3.0857
41	E	A	-3.1324
42	V	A	-1.8308
43	K	A	-2.0722
44	F	A	-1.1970
45	N	A	-1.2942
46	W	A	0.3802
47	Y	A	1.5049
48	V	A	1.6991
49	D	A	-0.5091
50	G	A	0.3196
51	V	A	1.6468
52	E	A	0.1447
53	V	A	0.0788
54	H	A	-1.7843
55	N	A	-2.0281
56	A	A	-1.8341
57	K	A	-2.4234
58	T	A	-2.0715
59	K	A	-2.7664
60	P	A	-2.4053
61	R	A	-3.1059
62	E	A	-3.1595
63	E	A	-3.0331
64	Q	A	-1.5431
65	Y	A	0.1766
66	N	A	-1.0767
67	S	A	-1.1907
68	T	A	-1.8711
69	Y	A	-2.4558
70	R	A	-2.0848
71	V	A	0.0000
72	V	A	0.0000
73	S	A	0.0000
74	V	A	-0.5342
75	L	A	-0.3938