Project name: 92191db4ba127c7

Chain sequence(s)	A: SSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:07)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:07)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:07)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:07)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:37)

• Minimal score value: -3.1953
• Maximal score value: 1.5126
• Average score: -0.7025
• Total score value: -118.0228

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
7	S	A	-0.7800
8	S	A	-0.4515
9	L	A	0.0000
10	P	A	-0.9458
11	Q	A	-1.5008
12	S	A	-0.8925
13	F	A	0.0000
14	L	A	0.0000
15	L	A	-0.8309
16	K	A	-1.8666
17	C	A	0.0000
18	L	A	0.0000
19	E	A	-2.5360
20	Q	A	-2.5856
21	V	A	0.0000
22	R	A	-3.1714
23	K	A	-3.1953
24	I	A	0.0000
25	Q	A	-2.0859
26	G	A	-1.6341
27	D	A	-1.3603
28	G	A	0.0000
29	A	A	-1.3108
30	A	A	-1.2478
31	L	A	0.0000
32	Q	A	-1.6578
33	E	A	-2.5993
34	K	A	-2.5412
35	L	A	0.0000
36	C	A	-1.5673
37	A	A	-1.1761
38	T	A	-1.2266
39	Y	A	-0.5452
40	K	A	-1.7651
41	L	A	-1.5519
42	C	A	-1.4381
43	H	A	-1.9274
44	P	A	-1.4134
45	E	A	-2.2008
46	E	A	-2.0538
47	L	A	0.0000
48	V	A	1.0956
49	L	A	1.5126
50	L	A	0.6288
51	G	A	0.0000
52	H	A	-0.2530
53	S	A	0.0620
54	L	A	-0.1913
55	G	A	-0.5700
56	I	A	0.0000
57	P	A	-0.1797
58	W	A	0.1161
59	A	A	-0.0108
60	P	A	-0.3176
61	L	A	0.0000
62	S	A	-0.5839
63	S	A	-0.8190
64	C	A	-0.6365
65	P	A	-0.8300
66	S	A	-0.7516
67	Q	A	-1.1791
68	A	A	-0.1578
69	L	A	0.7674
70	Q	A	-0.6257
71	L	A	-0.0929
72	A	A	-0.2788
73	G	A	-0.5722
74	C	A	0.0000
75	L	A	0.0000
76	S	A	-0.3251
77	Q	A	-0.4946
78	L	A	0.0000
79	H	A	0.0000
80	S	A	-0.0692
81	G	A	0.0000
82	L	A	0.0000
83	F	A	0.2348
84	L	A	0.0766
85	Y	A	0.0000
86	Q	A	-0.3877
87	G	A	-0.6198
88	L	A	0.0000
89	L	A	0.0000
90	Q	A	-1.8302
91	A	A	-1.2418
92	L	A	0.0000
93	E	A	-2.4585
94	G	A	-2.0466
95	I	A	0.0000
96	S	A	-1.1611
97	P	A	-1.4461
98	E	A	-2.2139
99	L	A	0.0000
100	G	A	-1.5345
101	P	A	-1.1874
102	T	A	0.0000
103	L	A	0.0000
104	D	A	-1.4442
105	T	A	-0.4243
106	L	A	0.0000
107	Q	A	-0.7102
108	L	A	0.2085
109	D	A	-0.9958
110	V	A	0.0000
111	A	A	-0.5597
112	D	A	-1.6676
113	F	A	0.0000
114	A	A	0.0000
115	T	A	-0.9952
116	T	A	-1.2042
117	I	A	0.0000
118	W	A	0.0000
119	Q	A	-2.3716
120	Q	A	-1.8741
121	M	A	0.0000
122	E	A	-3.1011
123	E	A	-2.9174
124	L	A	-1.4206
125	G	A	-1.4651
126	M	A	-0.6940
127	A	A	-1.0536
128	P	A	-0.0739
129	A	A	0.2654
130	L	A	1.2333
131	Q	A	0.0121
132	P	A	-0.3270
133	T	A	-0.6218
134	Q	A	-1.3933
135	G	A	-0.8686
136	A	A	-0.2755
137	M	A	-0.1614
138	P	A	0.0306
139	A	A	0.0421
140	F	A	0.0000
141	A	A	-0.0942
142	S	A	0.1063
143	A	A	0.2557
144	F	A	0.8037
145	Q	A	0.0806
146	R	A	-0.7020
147	R	A	-0.4479
148	A	A	0.0000
149	G	A	0.0000
150	G	A	0.0000
151	V	A	0.0000
152	L	A	0.0000
153	V	A	0.0000
154	A	A	0.0000
155	S	A	-0.7547
156	H	A	-0.5184
157	L	A	0.0000
158	Q	A	-1.0319
159	S	A	-0.8936
160	F	A	0.0000
161	L	A	0.0000
162	E	A	-1.9059
163	V	A	-1.1309
164	S	A	0.0000
165	Y	A	-1.9654
166	R	A	-2.7763
167	V	A	0.0000
168	L	A	0.0000
169	R	A	-2.8248
170	H	A	-2.6903
171	L	A	-1.4250
172	A	A	-1.8164
173	Q	A	-2.0499
174	P	A	-0.7815