Project name: 92c6e5be88e76d7

Chain sequence(s)	A: GNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:49)

• Minimal score value: -4.0149
• Maximal score value: 2.0815
• Average score: -1.2572
• Total score value: -286.6425

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
11	G	A	-1.1670
12	N	A	-1.6424
13	T	A	-1.0498
14	G	A	-0.9809
15	A	A	-0.6046
16	P	A	-0.6615
17	G	A	-0.8733
18	S	A	-0.5337
19	P	A	-0.3774
20	G	A	0.0569
21	V	A	1.2129
22	S	A	-0.0138
23	G	A	-0.7579
24	P	A	-1.5125
25	K	A	-2.6774
26	G	A	-2.6689
27	D	A	-2.7004
28	A	A	-1.6539
29	G	A	-1.5982
30	Q	A	-2.0451
31	P	A	-1.7720
32	G	A	-2.2548
33	E	A	-3.1972
34	K	A	-3.0230
35	G	A	-1.9685
36	S	A	-1.2320
37	P	A	-0.9920
38	G	A	-0.9273
39	A	A	-0.9255
40	Q	A	-1.6091
41	G	A	-1.2074
42	P	A	-0.9449
43	P	A	-0.8283
44	G	A	-0.6572
45	A	A	-0.4459
46	P	A	-0.6330
47	G	A	-0.4275
48	P	A	0.1303
49	L	A	1.5705
50	G	A	1.2201
51	I	A	2.0815
52	A	A	1.1169
53	G	A	0.9249
54	I	A	1.6719
55	T	A	0.5851
56	G	A	-0.4603
57	A	A	-1.2848
58	R	A	-1.8073
59	G	A	-0.4368
60	L	A	0.8406
61	A	A	0.4159
62	G	A	-0.3502
63	P	A	-0.7073
64	P	A	-0.4666
65	G	A	-0.1984
66	M	A	0.5245
67	P	A	-0.0410
68	G	A	-0.8890
69	P	A	-1.5303
70	R	A	-2.3222
71	G	A	-1.6593
72	S	A	-1.1364
73	P	A	-0.9293
74	G	A	-1.1081
75	P	A	-1.2327
76	Q	A	-1.2850
77	G	A	-0.6585
78	V	A	0.3387
79	K	A	-1.5542
80	G	A	-1.9797
81	E	A	-2.8393
82	S	A	-2.0343
83	G	A	-1.8366
84	K	A	-2.4088
85	P	A	-1.5388
86	G	A	-1.1928
87	A	A	-0.9681
88	N	A	-1.2722
89	G	A	-0.4471
90	L	A	0.5787
91	S	A	-0.3698
92	G	A	-1.5722
93	E	A	-2.9459
94	R	A	-3.1822
95	G	A	-2.1318
96	P	A	-1.3964
97	P	A	-1.2331
98	G	A	-1.2240
99	P	A	-1.0681
100	Q	A	-1.2990
101	G	A	-0.5710
102	L	A	0.9353
103	P	A	0.4323
104	G	A	0.4540
105	L	A	1.3777
106	A	A	0.4060
107	G	A	-0.1549
108	T	A	-0.4487
109	A	A	-0.8533
110	G	A	-1.5834
111	E	A	-2.6618
112	P	A	-2.3381
113	G	A	-2.7125
114	R	A	-3.6960
115	D	A	-3.4736
116	G	A	-2.7288
117	N	A	-2.5626
118	P	A	-1.9078
119	G	A	-1.6858
120	S	A	-1.4741
121	D	A	-1.9311
122	G	A	-0.8543
123	L	A	0.2620
124	P	A	-0.9655
125	G	A	-1.6926
126	R	A	-2.9111
127	D	A	-3.1761
128	G	A	-2.1680
129	S	A	-1.4423
130	P	A	-1.3990
131	G	A	-1.4836
132	G	A	-1.9575
133	K	A	-3.0871
134	G	A	-2.8694
135	D	A	-3.7694
136	R	A	-4.0149
137	G	A	-3.1318
138	E	A	-3.5070
139	N	A	-2.9257
140	G	A	-1.8790
141	S	A	-1.1909
142	P	A	-0.9438
143	G	A	-0.8271
144	A	A	-0.4971
145	P	A	-0.6411
146	G	A	-0.7724
147	A	A	-0.6219
148	P	A	-0.9068
149	G	A	-1.2866
150	H	A	-1.5583
151	P	A	-1.2241
152	G	A	-1.2002
153	P	A	-0.9665
154	P	A	-0.5064
155	G	A	-0.4374
156	P	A	0.1255
157	V	A	1.1932
158	G	A	0.0958
159	P	A	-0.3929
160	A	A	-0.6606
161	G	A	-1.9922
162	K	A	-2.4688
163	S	A	-2.3666
164	G	A	-2.4744
165	D	A	-3.5241
166	R	A	-3.5352
167	G	A	-2.8646
168	E	A	-2.9371
169	S	A	-1.7594
170	G	A	-1.2293
171	P	A	-0.8707
172	A	A	-0.4952
173	G	A	-0.7114
174	P	A	-0.5753
175	A	A	-0.4162
176	G	A	-0.6361
177	A	A	-0.4449
178	P	A	-0.6050
179	G	A	-0.7914
180	P	A	-0.6391
181	A	A	-0.7207
182	G	A	-1.3897
183	S	A	-1.4580
184	R	A	-2.3577
185	G	A	-1.6632
186	A	A	-0.8831
187	P	A	-1.1283
188	G	A	-1.3236
189	P	A	-1.3274
190	Q	A	-2.1435
191	G	A	-2.0133
192	P	A	-2.1343
193	R	A	-3.2926
194	G	A	-3.2011
195	D	A	-3.7915
196	K	A	-3.7456
197	G	A	-2.7934
198	E	A	-3.2002
199	T	A	-2.6051
200	G	A	-3.0894
201	E	A	-3.4125
202	R	A	-3.2579
203	G	A	-1.9837
204	A	A	-0.8474
205	A	A	-0.2577
206	G	A	-0.2483
207	I	A	0.4151
208	K	A	-1.9970
209	G	A	-2.6222
210	H	A	-2.1681
211	R	A	-2.5726
212	G	A	-1.3003
213	F	A	0.5621
214	P	A	-0.6439
215	G	A	-1.4926
216	N	A	-1.5527
217	P	A	-1.5762
218	G	A	-1.5405
219	A	A	-0.7644
220	P	A	-0.8942
221	G	A	-1.2241
222	S	A	-0.8259
223	P	A	-0.8809
224	G	A	-1.0454
225	P	A	-0.8295
226	A	A	-1.1774
227	G	A	-1.8814
228	Q	A	-2.1425
229	Q	A	-1.8474
230	G	A	-0.9999
231	A	A	0.2087
232	I	A	1.4324
233	G	A	0.2430
234	S	A	-0.2079
235	P	A	-0.4847
236	G	A	-0.8104
237	P	A	-0.5383
238	A	A	-0.2143