Project name: 9301ab5c8328c9f

Status: done

Started: 2026-07-01 15:24:07
Settings
Chain sequence(s) B: GQLTAQSISVQDFPDGTGVLTVTLTVSSVAPLTLMWQDVETGEVRRAATL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:14)
Show buried residues

Minimal score value
-2.8175
Maximal score value
2.2769
Average score
-0.1819
Total score value
-9.0951

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B -0.1758
2 Q B -0.6919
3 L B 0.1159
4 T B -0.0807
5 A B 0.1216
6 Q B -0.6517
7 S B 0.3559
8 I B 2.2769
9 S B 1.6009
10 V B 1.5405
11 Q B -0.6305
12 D B -1.6721
13 F B -0.7787
14 P B -1.1665
15 D B -2.0792
16 G B -1.5469
17 T B -1.1214
18 G B -0.6858
19 V B 0.9379
20 L B 1.4952
21 T B 1.4741
22 V B 1.4942
23 T B 0.5332
24 L B 0.6076
25 T B 0.4149
26 V B 1.7575
27 S B 0.4346
28 S B 0.6394
29 V B 1.9248
30 A B 0.8605
31 P B 0.7053
32 L B 0.9683
33 T B 0.3780
34 L B 0.2813
35 M B -0.1732
36 W B -0.6143
37 Q B -2.0881
38 D B -2.2414
39 V B -0.3963
40 E B -1.9358
41 T B -1.6462
42 G B -1.8917
43 E B -2.6411
44 V B -1.7305
45 R B -2.8175
46 R B -2.1763
47 A B -0.8194
48 A B 0.0329
49 T B 0.5418
50 L B 1.8647
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018