Project name: 65r4

Chain sequence(s)	A: MIAGVDQALAATGQASQRAAGASGGVTVGVGVGTEQRNLSVVAPSQFTFSSRSPDFVDETAGQSWCAILGLNQFHFAVTNDGVI
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:31)

• Minimal score value: -3.2512
• Maximal score value: 2.6276
• Average score: -0.3338
• Total score value: -28.0371

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	2.0395
2	I	A	2.6276
3	A	A	0.9960
4	G	A	0.3873
5	V	A	1.4759
6	D	A	-0.5790
7	Q	A	-1.0650
8	A	A	0.0886
9	L	A	0.8456
10	A	A	-0.3358
11	A	A	-0.5617
12	T	A	-0.2420
13	G	A	-0.7448
14	Q	A	-1.5557
15	A	A	-1.0963
16	S	A	-1.3627
17	Q	A	-2.6703
18	R	A	-2.6158
19	A	A	0.0000
20	A	A	-1.5149
21	G	A	-1.4633
22	A	A	-1.1481
23	S	A	-0.5997
24	G	A	-0.4363
25	G	A	0.0551
26	V	A	0.1005
27	T	A	0.1123
28	V	A	0.1421
29	G	A	-0.9531
30	V	A	0.0000
31	G	A	-1.9421
32	V	A	-1.2921
33	G	A	-1.3836
34	T	A	-1.6188
35	E	A	-3.0461
36	Q	A	-3.2250
37	R	A	-3.2512
38	N	A	-2.2697
39	L	A	-0.2550
40	S	A	0.2944
41	V	A	1.3483
42	V	A	1.6444
43	A	A	0.7406
44	P	A	-0.3552
45	S	A	-0.2067
46	Q	A	0.1314
47	F	A	1.7508
48	T	A	1.3419
49	F	A	1.9938
50	S	A	0.4988
51	S	A	-0.4134
52	R	A	-1.7910
53	S	A	-1.4828
54	P	A	-0.9639
55	D	A	-1.0394
56	F	A	0.2715
57	V	A	0.4921
58	D	A	-1.7545
59	E	A	-2.4486
60	T	A	-1.5027
61	A	A	-1.0608
62	G	A	-0.8438
63	Q	A	-1.3136
64	S	A	-0.3149
65	W	A	0.2008
66	C	A	0.1582
67	A	A	0.2743
68	I	A	0.1666
69	L	A	0.6454
70	G	A	0.1585
71	L	A	1.1186
72	N	A	0.1304
73	Q	A	-0.4178
74	F	A	0.0318
75	H	A	-0.3895
76	F	A	0.8188
77	A	A	0.6464
78	V	A	1.0963
79	T	A	-0.1168
80	N	A	-1.2711
81	D	A	-1.4537
82	G	A	-0.0872
83	V	A	1.7998
84	I	A	1.7940