Project name: query_structure

Status: done

Started: 2026-03-17 00:18:15
Settings
Chain sequence(s) A: QLQLVESGGGLVQVGGSLRLSCAASGRTFSRYAMGWFRQAPGKEREFVAAISWSGDNTYYVDSVKGRFTISRDNTKNTVFLQMNSLKPEDTAVYFCAADGPVAGSWYYSPYEYEYDYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:49)
Show buried residues

Minimal score value
-3.2666
Maximal score value
2.3674
Average score
-0.6642
Total score value
-85.0127

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.8833
2 L A -1.6798
3 Q A -1.3054
4 L A 0.0000
5 V A 0.7665
6 E A 0.0000
7 S A -0.6325
8 G A -1.0161
9 G A -0.8124
10 G A -0.0171
11 L A 1.0927
12 V A 0.1873
13 Q A -0.8576
14 V A -0.5862
15 G A -0.9233
16 G A -0.6024
17 S A -0.9466
18 L A -0.9266
19 R A -2.1064
20 L A 0.0000
21 S A -0.3741
22 C A 0.0000
23 A A -0.2776
24 A A 0.0000
25 S A -1.4612
26 G A -2.1161
27 R A -2.5107
28 T A -1.9556
29 F A 0.0000
30 S A -1.8801
31 R A -2.0907
32 Y A 0.0000
33 A A -0.4174
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A -0.2116
38 R A 0.0000
39 Q A -1.7479
40 A A -1.7755
41 P A -1.2851
42 G A -1.8131
43 K A -2.9694
44 E A -3.2666
45 R A -2.3838
46 E A -1.2936
47 F A 0.0000
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 S A -0.7429
53 W A -0.9762
54 S A -1.3262
55 G A -1.4878
56 D A -2.2704
57 N A -1.3119
58 T A -0.3862
59 Y A 0.4656
60 Y A -0.3529
61 V A -0.7959
62 D A -2.2712
63 S A -1.7686
64 V A 0.0000
65 K A -2.4693
66 G A -1.7780
67 R A -1.4132
68 F A 0.0000
69 T A -0.7531
70 I A 0.0000
71 S A -0.6222
72 R A -1.0969
73 D A -1.5239
74 N A -1.9395
75 T A -1.5466
76 K A -2.4185
77 N A -1.9993
78 T A 0.0000
79 V A 0.0000
80 F A -0.4463
81 L A 0.0000
82 Q A -1.2025
83 M A 0.0000
84 N A -1.3534
85 S A -1.0351
86 L A 0.0000
87 K A -1.8874
88 P A -1.6041
89 E A -2.1820
90 D A 0.0000
91 T A -0.8485
92 A A 0.0000
93 V A -0.3973
94 Y A 0.0000
95 F A -0.0705
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 D A 0.0000
100 G A -0.8260
101 P A -0.1420
102 V A 1.0829
103 A A 0.6659
104 G A 0.1230
105 S A 1.2661
106 W A 2.0098
107 Y A 2.3674
108 Y A 2.0883
109 S A 1.0504
110 P A 0.0000
111 Y A 0.5074
112 E A -1.2304
113 Y A -1.0174
114 E A -2.2162
115 Y A 0.0000
116 D A -2.0762
117 Y A -1.0413
118 W A -0.1019
119 G A -0.1243
120 Q A -0.8844
121 G A -0.4791
122 T A 0.0000
123 Q A -0.9749
124 V A 0.0000
125 T A -0.1474
126 V A 0.0000
127 S A -0.4661
128 S A -0.5548
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018