Project name: myo_allproteins

Chain sequence(s)	A: VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:28)

• Minimal score value: -3.8907
• Maximal score value: 1.2029
• Average score: -1.2573
• Total score value: -192.3724

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	V	A	1.2029
2	L	A	0.0000
3	S	A	-1.0865
4	E	A	-2.3888
5	G	A	-1.8359
6	E	A	-1.8456
7	W	A	0.0000
8	Q	A	-1.9352
9	L	A	-1.1660
10	V	A	0.0000
11	L	A	-0.9944
12	H	A	-0.9775
13	V	A	0.0000
14	W	A	0.0000
15	A	A	-1.2185
16	K	A	-1.8636
17	V	A	0.0000
18	E	A	-2.2207
19	A	A	-1.5106
20	D	A	-1.5144
21	V	A	-0.9412
22	A	A	-0.7991
23	G	A	-0.7341
24	H	A	0.0000
25	G	A	0.0000
26	Q	A	0.0000
27	D	A	-1.0721
28	I	A	0.0000
29	L	A	0.0000
30	I	A	0.0000
31	R	A	-2.1485
32	L	A	0.0000
33	F	A	0.0000
34	K	A	-2.3103
35	S	A	-1.4107
36	H	A	-1.2344
37	P	A	-1.6944
38	E	A	-1.8370
39	T	A	0.0000
40	L	A	-2.6055
41	E	A	-3.4941
42	K	A	-2.8865
43	F	A	-2.5930
44	D	A	-3.4505
45	R	A	-2.9406
46	F	A	0.0000
47	K	A	-3.8907
48	H	A	-3.0525
49	L	A	0.0000
50	K	A	-2.8854
51	T	A	-2.2584
52	E	A	-2.6066
53	A	A	-1.7277
54	E	A	-2.3254
55	M	A	0.0000
56	K	A	-2.3562
57	A	A	-1.7253
58	S	A	-2.1029
59	E	A	-3.0263
60	D	A	-2.4993
61	L	A	0.0000
62	K	A	-2.5370
63	K	A	-2.5346
64	H	A	-1.3166
65	G	A	0.0000
66	V	A	-0.2625
67	T	A	-0.0853
68	V	A	0.3595
69	L	A	0.0000
70	T	A	0.0486
71	A	A	0.1742
72	L	A	0.0000
73	G	A	0.0000
74	A	A	-0.9213
75	I	A	0.0000
76	L	A	0.0000
77	K	A	-2.5618
78	K	A	-2.8382
79	K	A	-2.5437
80	G	A	-1.5936
81	H	A	-2.4399
82	H	A	0.0000
83	E	A	-2.6887
84	A	A	-1.5964
85	E	A	-1.5182
86	L	A	0.0000
87	K	A	-1.9279
88	P	A	-1.2269
89	L	A	-0.6105
90	A	A	0.0000
91	Q	A	-1.3847
92	S	A	-1.6130
93	H	A	-1.5483
94	A	A	0.0000
95	T	A	-1.5306
96	K	A	-2.6588
97	H	A	-2.4882
98	K	A	-2.2879
99	I	A	-1.3411
100	P	A	-1.1278
101	I	A	-1.3610
102	K	A	-2.0429
103	Y	A	-1.2157
104	L	A	0.0000
105	E	A	-2.4512
106	F	A	-1.3436
107	I	A	-1.0647
108	S	A	0.0000
109	E	A	-2.3517
110	A	A	0.0000
111	I	A	0.0000
112	I	A	-1.3174
113	H	A	-2.0541
114	V	A	0.0000
115	L	A	0.0000
116	H	A	-1.9135
117	S	A	-1.3056
118	R	A	-1.4993
119	H	A	-1.3876
120	P	A	-1.2564
121	G	A	-1.1089
122	D	A	-1.4648
123	F	A	0.0000
124	G	A	-1.3917
125	A	A	-1.3601
126	D	A	-2.1097
127	A	A	0.0000
128	Q	A	-1.7391
129	G	A	-1.4584
130	A	A	0.0000
131	M	A	0.0000
132	N	A	-2.1049
133	K	A	-1.9340
134	A	A	0.0000
135	L	A	0.0000
136	E	A	-3.0683
137	L	A	-1.5868
138	F	A	0.0000
139	R	A	-2.2661
140	K	A	-2.3420
141	D	A	-1.8163
142	I	A	0.0000
143	A	A	-1.6985
144	A	A	-1.6689
145	K	A	-1.9862
146	Y	A	0.0000
147	K	A	-2.8116
148	E	A	-2.5845
149	L	A	-1.1226
150	G	A	-1.3588
151	Y	A	-1.1305
152	Q	A	-1.8187
153	G	A	-1.3116