Project name: 948e1bef9ed374f

Status: done

Started: 2024-12-26 07:50:44
Settings
Chain sequence(s) P: GCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDFKLS
input PDB
Selected Chain(s) P
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with P chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:40)
Show buried residues

Minimal score value
-3.3991
Maximal score value
1.8571
Average score
-0.5612
Total score value
-145.358

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
244 G P -0.2537
245 C P 0.4532
246 G P 0.0000
247 E P 0.3725
248 L P 0.0000
249 V P 1.6552
250 W P 0.4622
251 V P 0.0000
252 G P 0.0000
253 E P -2.2880
254 P P -0.8420
255 L P 1.0145
256 T P 0.5913
257 L P 0.1213
258 R P -2.0604
259 T P -1.4893
260 A P -1.5690
261 E P -1.9288
262 T P -0.6976
263 I P 0.1740
264 T P 0.0132
265 G P 0.0638
266 K P -0.1198
267 Y P 0.0422
268 G P 0.0428
269 V P 0.2571
270 W P 0.3383
271 M P -0.0476
272 R P -0.6585
273 D P -0.6888
274 P P -0.6956
275 K P -0.4746
276 P P -0.2907
277 T P 0.4309
278 Y P 1.4815
279 P P 0.7996
280 Y P 1.1993
281 T P 0.0529
282 Q P -0.6089
283 E P -1.1273
284 T P 0.0000
285 T P 0.0000
286 W P 0.0000
287 R P -1.5951
288 I P -1.2985
289 D P -1.8835
290 T P -0.5589
291 V P 0.9346
292 G P -0.2592
293 T P -0.6763
294 D P -1.8330
295 V P -0.5070
296 R P -0.9815
297 Q P -0.6889
298 V P 0.0000
299 F P -0.3343
300 E P 0.0000
301 Y P -0.2244
302 D P -0.2297
303 L P 0.5867
304 I P 1.7583
305 S P 0.7209
306 Q P 0.1891
307 F P 1.8571
308 M P 1.1094
309 Q P 0.2769
310 G P 0.0965
311 Y P 0.7502
312 P P 0.0034
313 S P -0.4749
314 K P -0.6078
315 V P 0.3989
316 H P 0.0000
317 I P 0.5537
318 L P 0.0000
319 P P -0.6445
320 R P -1.4232
321 P P -1.5783
322 L P -0.8991
323 E P -0.7744
324 S P -0.5198
325 T P -0.1425
326 G P -0.0569
327 A P 0.0000
328 V P 0.0000
329 V P 0.0000
330 Y P 0.1718
331 S P -0.4844
332 G P 0.0000
333 S P 0.0000
334 L P 0.0000
335 Y P 0.0000
336 F P 0.0000
337 Q P 0.0000
338 G P 0.0000
339 A P -1.4500
340 E P -2.0835
341 S P -1.5628
342 R P -1.6538
343 T P -1.9097
344 V P 0.0000
345 I P 0.0000
346 R P -1.6250
347 Y P 0.0000
348 E P -1.5744
349 L P 0.0000
350 N P -1.9548
351 T P -1.7159
352 E P -2.1341
353 T P -1.2746
354 V P -1.2390
355 K P -2.7146
356 A P -2.7212
357 E P -3.1915
358 K P -2.9355
359 E P -2.9254
360 I P 0.0000
361 P P -0.9791
362 G P -0.9476
363 A P -0.9250
364 G P 0.0000
365 Y P 0.0000
366 H P 0.0000
367 G P -1.2402
368 Q P -0.5102
369 F P 0.5606
370 P P 0.2821
371 Y P 0.7348
372 S P 0.4658
373 W P 1.2315
374 G P 0.5627
375 G P 0.3162
376 Y P 1.2971
377 T P 0.2846
378 D P -0.3220
379 I P 0.0000
380 D P 0.0000
381 L P 0.0000
382 A P 0.0000
383 V P -0.5466
384 D P -1.6755
385 E P -2.2252
386 A P -1.3442
387 G P -1.4489
388 L P 0.0000
389 W P 0.0000
390 V P 0.0000
391 I P 0.0000
392 Y P -0.4399
393 S P 0.0000
394 T P -1.7367
395 D P -2.6470
396 E P -2.5860
397 A P -2.2592
398 K P -2.9616
399 G P -2.6261
400 A P -2.5117
401 I P 0.0000
402 V P 0.0000
403 L P 0.0000
404 S P 0.0000
405 K P 0.0000
406 L P 0.0000
407 N P -2.1534
408 P P -1.7259
409 E P -2.9948
410 N P -3.3637
411 L P 0.0000
412 E P -3.3991
413 L P -1.9528
414 E P -2.7150
415 Q P -2.0740
416 T P -1.1271
417 W P -0.9739
418 E P -1.8657
419 T P 0.0000
420 N P -2.0610
421 I P 0.0000
422 R P -2.8829
423 K P 0.0000
424 Q P -2.5673
425 S P -1.1706
426 V P 0.0000
427 A P 0.0000
428 N P 0.0000
429 A P 0.0000
430 F P 0.0000
431 I P 0.0000
432 I P 0.0000
433 C P 0.3839
434 G P 0.0548
435 T P 0.0000
436 L P 0.0000
437 Y P 0.0000
438 T P 0.0000
439 V P 0.0000
440 S P -0.1442
441 S P -0.1243
442 Y P 0.5787
443 T P 0.1248
444 S P -0.1475
445 A P -0.2901
446 D P 0.0000
447 A P 0.0000
448 T P -0.3163
449 V P 0.0000
450 N P -0.4843
451 F P 0.6145
452 A P 0.0000
453 Y P 0.0000
454 D P 0.0000
455 T P 0.1785
456 G P -0.1961
457 T P 0.0989
458 G P 0.1321
459 I P 0.8238
460 S P 0.4281
461 K P -0.2762
462 T P -0.1764
463 L P -0.0449
464 T P -0.1657
465 I P 0.0000
466 P P -0.3387
467 F P -1.5850
468 K P -2.9668
469 N P -3.2924
470 R P -3.0184
471 Y P -1.8139
472 K P -1.8417
473 Y P -0.4032
474 S P -0.8019
475 S P -1.0156
476 M P 0.0000
477 I P 0.0000
478 D P 0.0000
479 Y P 0.0000
480 N P -1.0168
481 P P -0.8015
482 L P -0.6702
483 E P -1.9328
484 K P -2.1624
485 K P -1.9964
486 L P 0.0000
487 F P 0.0000
488 A P 0.0000
489 W P -0.8281
490 D P -2.4690
491 N P -2.4098
492 L P -1.5399
493 N P -1.8498
494 M P 0.0000
495 V P 0.2436
496 T P 0.0261
497 Y P -0.9541
498 D P -2.4132
499 F P -1.2399
500 K P -0.8740
501 L P 0.5373
502 S P 0.4521
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018