Project name: query_structure

Status: done

Started: 2026-03-16 23:50:03
Settings
Chain sequence(s) A: KIPCGESCVWIPCLTSVFNCKCENKVCYHD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:25)
Show buried residues

Minimal score value
-2.6541
Maximal score value
2.4819
Average score
-0.109
Total score value
-3.2709

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -1.8555
2 I A 0.5508
3 P A -0.1918
4 C A -0.0042
5 G A -0.2438
6 E A -0.0954
7 S A 0.0325
8 C A 0.5177
9 V A 1.1874
10 W A 2.1184
11 I A 2.4819
12 P A 1.1810
13 C A 0.0000
14 L A 2.0505
15 T A 1.3640
16 S A 0.9671
17 V A 2.3841
18 F A 2.0952
19 N A -0.4249
20 C A 0.0000
21 K A -2.2529
22 C A -1.4399
23 E A -2.4584
24 N A -2.3722
25 K A -1.8579
26 V A -1.2121
27 C A 0.0000
28 Y A -1.5659
29 H A -1.5725
30 D A -2.6541
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018