Project name: dfhfdg

Chain sequence(s)	A: MKLLKVAAIAAIVFSGSALAGVVPQYGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQTDARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFGGGNGAAVDQTASNSSVNVTQVGFGNNATAHQY
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:38)
[CRITICAL]   pyMol:    Pymol encountered an error: /bin/sh: pymol: command not found Movie         
                       creation failed.                                                            (00:00:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:39)

• Minimal score value: -3.9331
• Maximal score value: 2.6446
• Average score: -0.4337
• Total score value: -65.4861

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.8457
2	K	A	-0.2540
3	L	A	1.5404
4	L	A	1.5563
5	K	A	-0.0184
6	V	A	1.3794
7	A	A	0.1763
8	A	A	0.4143
9	I	A	0.6110
10	A	A	1.1903
11	A	A	0.0000
12	I	A	2.6446
13	V	A	0.0000
14	F	A	2.4296
15	S	A	0.0000
16	G	A	-0.0558
17	S	A	0.0547
18	A	A	1.0415
19	L	A	2.2273
20	A	A	1.7706
21	G	A	1.7054
22	V	A	1.8039
23	V	A	0.9270
24	P	A	0.0919
25	Q	A	-0.7712
26	Y	A	0.5135
27	G	A	-0.8240
28	G	A	-1.0222
29	G	A	-1.2912
30	G	A	-1.7733
31	N	A	-2.2420
32	H	A	-2.0801
33	G	A	-1.6595
34	G	A	-1.5101
35	G	A	-1.5560
36	G	A	-1.8898
37	N	A	-2.3965
38	N	A	-2.4006
39	S	A	-1.9091
40	G	A	-2.2763
41	P	A	-2.9643
42	N	A	-3.2600
43	S	A	0.0000
44	E	A	-2.2275
45	L	A	0.0000
46	N	A	-0.0284
47	I	A	0.0000
48	Y	A	1.1857
49	Q	A	0.0000
50	Y	A	0.3013
51	G	A	-0.5478
52	G	A	-0.5753
53	G	A	-0.4409
54	N	A	0.0000
55	S	A	0.6260
56	A	A	0.0000
57	L	A	1.3137
58	A	A	0.0000
59	L	A	0.9995
60	Q	A	0.0000
61	T	A	-0.1467
62	D	A	-1.4782
63	A	A	0.0000
64	R	A	-3.9331
65	N	A	-3.8504
66	S	A	0.0000
67	D	A	-2.8221
68	L	A	0.0000
69	T	A	-0.7443
70	I	A	0.0000
71	T	A	-0.2328
72	Q	A	0.0000
73	H	A	-0.8231
74	G	A	-0.7517
75	G	A	-0.5039
76	G	A	-0.5464
77	N	A	0.0000
78	G	A	-0.2396
79	A	A	0.0000
80	D	A	-1.0449
81	V	A	0.0000
82	G	A	0.0000
83	Q	A	0.0000
84	G	A	-1.1750
85	S	A	0.0000
86	D	A	-2.9318
87	D	A	-3.2963
88	S	A	0.0000
89	S	A	-2.0853
90	I	A	0.0000
91	D	A	-1.3665
92	L	A	0.0000
93	T	A	0.0000
94	Q	A	0.0000
95	R	A	-1.4339
96	G	A	-0.2771
97	F	A	1.0203
98	G	A	0.0593
99	N	A	0.0000
100	S	A	-0.6111
101	A	A	0.0000
102	T	A	-0.8057
103	L	A	0.0000
104	D	A	-0.9081
105	Q	A	0.0000
106	W	A	-0.8770
107	N	A	-1.4462
108	G	A	0.0000
109	K	A	-3.0437
110	N	A	-3.1355
111	S	A	0.0000
112	E	A	-2.8332
113	M	A	0.0000
114	T	A	-1.2603
115	V	A	0.0000
116	K	A	-0.6965
117	Q	A	0.0000
118	F	A	0.6709
119	G	A	0.8264
120	G	A	0.0000
121	G	A	0.0906
122	N	A	0.0000
123	G	A	-0.7973
124	A	A	0.0000
125	A	A	-0.7836
126	V	A	0.0000
127	D	A	-1.0984
128	Q	A	0.0000
129	T	A	-0.6865
130	A	A	-0.9287
131	S	A	-1.9396
132	N	A	-2.4988
133	S	A	-1.5547
134	S	A	-1.6593
135	V	A	0.0000
136	N	A	-1.7201
137	V	A	0.0000
138	T	A	-0.0977
139	Q	A	0.0000
140	V	A	1.8471
141	G	A	1.4842
142	F	A	1.8615
143	G	A	-0.0455
144	N	A	-0.4999
145	N	A	-1.4903
146	A	A	-0.7712
147	T	A	-0.6636
148	A	A	-0.9520
149	H	A	-1.2116
150	Q	A	-0.5806
151	Y	A	0.5578