Project name: Mb5-11_I18L_I104L_LVLVVF_Lib2_Top1

Status: done

Started: 2026-07-06 06:59:06
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTVTVYAVTWYPRYGYGESGPVSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:48)
Show buried residues

Minimal score value
-2.7126
Maximal score value
1.5249
Average score
-0.7003
Total score value
-76.3306

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2396
2 Q A -0.9784
3 A A 0.0000
4 N A -1.9787
5 S A -1.5928
6 G A 0.0000
7 S A -1.3412
8 L A -0.9941
9 E A -1.7812
10 V A -0.4973
11 V A 0.3342
12 E A -1.3250
13 A A -1.1367
14 S A -1.4588
15 P A -1.7289
16 T A -1.1508
17 S A -1.1564
18 L A 0.0000
19 Q A -0.9111
20 L A 0.0000
21 S A -1.0047
22 W A 0.0000
23 D A -2.5044
24 A A -1.5480
25 F A 0.0000
26 H A -1.2640
27 R A 0.0000
28 Y A 0.9223
29 H A 0.3023
30 N A -0.5487
31 G A 0.1462
32 F A 1.5249
33 T A 0.7769
34 H A 0.1080
35 P A -0.3976
36 V A -0.9741
37 R A -1.5182
38 Y A -0.8735
39 Y A 0.0000
40 R A -0.8065
41 V A 0.0000
42 T A -0.6447
43 Y A -0.3683
44 G A 0.0000
45 E A -1.3772
46 T A -1.1182
47 G A -1.1652
48 G A -1.3086
49 N A -1.5124
50 S A -0.8834
51 P A -0.3938
52 V A 0.3178
53 Q A -1.2029
54 E A -1.8099
55 F A -0.7065
56 T A -0.1998
57 V A -0.3649
58 P A -0.9030
59 G A -1.1631
60 S A -1.0660
61 K A -1.5378
62 S A -1.0608
63 T A -0.7305
64 A A 0.0000
65 T A -0.3624
66 L A 0.0000
67 S A -0.7841
68 G A -0.9909
69 L A 0.0000
70 K A -2.3780
71 P A -1.9154
72 G A -1.1515
73 V A -1.1022
74 D A -2.0190
75 Y A 0.0000
76 T A -0.7001
77 V A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.3917
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.6979
85 Y A 0.0000
86 P A -0.4416
87 R A -1.1497
88 Y A 0.6006
89 G A 0.7007
90 Y A 1.1576
91 G A 0.4374
92 E A -0.6214
93 S A 0.0000
94 G A -1.0293
95 P A -0.6622
96 V A 0.0000
97 S A -0.5712
98 F A -0.5764
99 N A -1.6398
100 Y A -1.4399
101 R A -2.3922
102 T A 0.0000
103 E A -1.9259
104 L A -0.9959
105 D A -2.5718
106 K A -2.7126
107 P A -1.7870
108 S A -1.6382
109 Q A -1.6585
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018