Project name: gyra

Status: done

Started: 2026-03-20 02:11:10
Settings
Chain sequence(s) A: AITGDALVALPEGESVRIADIVPGARPNSDNAIDLKVLDRHGNPVLADRLFHSGEHPVYTVRTVEGLRVTGTANHPLLCLVDVAGVPTLLWKLIDEIKPGDYAVIQRSAFVPGLVRFLAQAIADELTDGRFYYAKVASVTDAGVQPVYSLRVDACDAAFITNGFVSHNTEAP
_: AMRY
input PDB
Selected Chain(s) A,_
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:10)
Show buried residues

Minimal score value
-3.393
Maximal score value
1.7869
Average score
-0.6989
Total score value
-123.0021

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -0.0448
2 I A 0.0000
3 T A 0.0000
4 G A -1.3704
5 D A -2.1926
6 A A 0.0000
7 L A -0.6743
8 V A 0.0000
9 A A 0.0000
10 L A -1.4123
11 P A -2.0819
12 E A -2.6406
13 G A -2.0229
14 E A -2.4939
15 S A -1.2929
16 V A -0.9076
17 R A -1.7933
18 I A 0.0000
19 A A -1.1473
20 D A -1.4512
21 I A -0.3072
22 V A -0.4406
23 P A -0.9429
24 G A -1.1221
25 A A -1.6658
26 R A -2.6459
27 P A -2.2972
28 N A -2.5266
29 S A -2.2596
30 D A -2.6401
31 N A -1.5563
32 A A -0.9979
33 I A -1.1458
34 D A -1.9666
35 L A -1.2077
36 K A -1.9665
37 V A 0.0000
38 L A 0.0000
39 D A 0.0000
40 R A -0.9708
41 H A -2.0569
42 G A -1.7316
43 N A -1.6192
44 P A -1.3887
45 V A -0.7364
46 L A -1.1082
47 A A 0.0000
48 D A -1.6177
49 R A -1.7399
50 L A 0.0000
51 F A 0.0000
52 H A 0.0000
53 S A 0.0000
54 G A 0.0000
55 E A -2.0011
56 H A -0.9408
57 P A -0.5197
58 V A 0.0000
59 Y A -0.7517
60 T A -1.0308
61 V A 0.0000
62 R A -2.0191
63 T A 0.0000
64 V A 0.2242
65 E A -1.0633
66 G A -1.1378
67 L A -1.2162
68 R A -2.3893
69 V A 0.0000
70 T A -1.0601
71 G A 0.0000
72 T A -0.9722
73 A A -1.7428
74 N A -1.5537
75 H A 0.0000
76 P A 0.0000
77 L A 0.0000
78 L A 0.0000
79 C A 0.0000
80 L A 0.0000
81 V A 0.2988
82 D A -0.5932
83 V A 1.2211
84 A A 0.5009
85 G A -0.2062
86 V A 0.7004
87 P A 0.0000
88 T A 0.4573
89 L A 0.5892
90 L A 1.0317
91 W A 0.4840
92 K A -0.8206
93 L A -1.2657
94 I A 0.0000
95 D A -3.0058
96 E A -3.0460
97 I A 0.0000
98 K A -2.6002
99 P A -1.2253
100 G A -0.8480
101 D A -1.3175
102 Y A -0.2086
103 A A 0.0000
104 V A 0.0000
105 I A 0.0000
106 Q A 0.0000
107 R A -1.4579
108 S A -1.2418
109 A A -0.3221
110 F A 1.3733
133 V A 1.4175
134 P A 0.2897
135 G A 0.1559
136 L A 0.0000
137 V A 1.7247
138 R A -0.2559
139 F A 1.0766
140 L A 1.7869
149 A A -0.2822
150 Q A -1.3419
151 A A -1.2607
152 I A -0.7081
153 A A -0.9207
154 D A -3.0523
155 E A -2.7986
156 L A 0.0000
157 T A -2.0070
158 D A -3.3930
159 G A -2.4663
160 R A -3.0048
161 F A 0.0000
162 Y A -0.2026
163 Y A 0.2440
164 A A 0.0000
165 K A -1.1268
166 V A 0.0000
167 A A -0.7130
168 S A -0.7821
169 V A -1.2974
170 T A -0.8580
171 D A -1.4940
172 A A -0.5772
173 G A -0.3190
174 V A 0.4507
175 Q A -0.5155
176 P A -1.0801
177 V A 0.0000
178 Y A -0.5231
179 S A 0.0000
180 L A 0.0000
181 R A -1.1828
182 V A -1.1935
183 D A -1.7593
184 A A -0.6106
185 C A 0.2044
186 D A -0.2610
187 A A -0.2356
188 A A 0.0000
189 F A 0.0000
190 I A 0.0000
191 T A 0.0000
192 N A -0.6326
193 G A 0.0000
194 F A 0.0000
195 V A 0.0000
196 S A 0.0000
197 H A 0.2228
198 N A 0.0000
199 T A 0.0000
200 E A -1.2337
201 A A -0.9481
202 P A -0.9256
1A A _ -0.0986
1B M _ 0.1921
1C R _ -1.0075
1D Y _ 0.1626
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018