Project name: 9578cb1c3804636

Status: done

Started: 2026-06-27 09:43:36
Settings
Chain sequence(s) A: MSHHHHHHSGFPEKPLYIYPYDAAYNLEFYLKYALVENEKDSEYYYNQLKKILPLYPLSPEELEKELKTVLERLKDPSRRYYGIKKFVELMTLALSKAYLYKKEGNYEKAKEYLEVAEKYLKEVEELIPKIEEIDPWDAKYLKSYIERLKELLEKVKENS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:12:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:12:28)
Show buried residues

Minimal score value
-4.0568
Maximal score value
2.4355
Average score
-1.2205
Total score value
-195.2779

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5649
2 S A -0.6063
3 H A -1.7302
4 H A -2.3319
5 H A -2.7157
6 H A -2.7463
7 H A -2.5358
8 H A -1.8929
9 S A -1.0570
10 G A -0.4798
11 F A 0.6661
12 P A -0.8983
13 E A -2.4914
14 K A -2.1541
15 P A -0.6642
16 L A 0.8339
17 Y A 1.9546
18 I A 2.4355
19 Y A 2.3483
20 P A 1.5153
21 Y A 1.5953
22 D A 0.6984
23 A A 0.5910
24 A A 0.0000
25 Y A 0.6889
26 N A 0.0000
27 L A 0.0000
28 E A -0.4140
29 F A 0.2499
30 Y A 0.0000
31 L A 0.0000
32 K A -1.1521
33 Y A 0.0000
34 A A 0.0000
35 L A 0.0000
36 V A -1.8138
37 E A -3.0352
38 N A -3.2192
39 E A -3.1513
40 K A -3.4278
41 D A -3.2123
42 S A -2.6797
43 E A -2.7192
44 Y A -1.1388
45 Y A -1.1196
46 Y A -1.5047
47 N A -1.7484
48 Q A -1.2939
49 L A 0.0000
50 K A -1.5891
51 K A -1.9623
52 I A -0.4785
53 L A 0.0000
54 P A 0.0921
55 L A 1.2846
56 Y A 1.0817
57 P A 0.2992
58 L A -0.3887
59 S A -1.4299
60 P A 0.0000
61 E A -3.3210
62 E A -3.1528
63 L A 0.0000
64 E A -3.3948
65 K A -3.9074
66 E A -3.0454
67 L A 0.0000
68 K A -3.4991
69 T A -2.4771
70 V A 0.0000
71 L A -2.5038
72 E A -3.3822
73 R A -2.6636
74 L A 0.0000
75 K A -3.3905
76 D A -2.6745
77 P A -1.1715
78 S A -1.0948
79 R A -1.4533
80 R A 0.0000
81 Y A 0.3400
82 Y A 0.4553
83 G A 0.0000
84 I A 0.0000
85 K A -0.9843
86 K A -1.2674
87 F A 0.0000
88 V A 0.0000
89 E A -1.1196
90 L A 0.0000
91 M A 0.0000
92 T A 0.0000
93 L A 0.0000
94 A A 0.0000
95 L A 0.0000
96 S A 0.0000
97 K A 0.0000
98 A A 0.0000
99 Y A 0.0000
100 L A 0.0000
101 Y A -1.7829
102 K A -2.3580
103 K A -2.7721
104 E A -2.8541
105 G A -2.2371
106 N A -2.2068
107 Y A -1.9641
108 E A -2.9232
109 K A -2.5324
110 A A 0.0000
111 K A -3.5883
112 E A -3.6249
113 Y A 0.0000
114 L A -2.5168
115 E A -3.1084
116 V A 0.0000
117 A A 0.0000
118 E A -2.8225
119 K A -3.3532
120 Y A 0.0000
121 L A 0.0000
122 K A -4.0568
123 E A -3.9435
124 V A 0.0000
125 E A -3.2696
126 E A -3.4764
127 L A -2.6190
128 I A 0.0000
129 P A -2.2492
130 K A -2.9719
131 I A 0.0000
132 E A -2.7003
133 E A -2.3436
134 I A 0.0598
135 D A -0.8247
136 P A -1.1467
137 W A 0.2536
138 D A 0.0000
139 A A 0.0000
140 K A -1.8883
141 Y A -0.4826
142 L A 0.0000
143 K A -2.1837
144 S A -1.5791
145 Y A -1.6007
146 I A 0.0000
147 E A -3.2116
148 R A -2.6363
149 L A 0.0000
150 K A -3.4112
151 E A -3.8244
152 L A 0.0000
153 L A 0.0000
154 E A -3.9165
155 K A -3.4783
156 V A 0.0000
157 K A -3.0187
158 E A -3.3197
159 N A -2.6452
160 S A -1.5580
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018