Project name: 957a580ca521750

Status: done

Started: 2026-04-09 11:18:54
Settings
Chain sequence(s) A: MTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:34)
Show buried residues

Minimal score value
-3.9328
Maximal score value
0.9373
Average score
-0.9024
Total score value
-134.4603

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5894
2 T A -0.3731
3 S A -0.9156
4 K A -2.0765
5 I A -1.7623
6 E A -3.0384
7 Q A -2.6152
8 P A -1.7057
9 R A -2.2056
10 W A -0.5747
11 A A -1.3319
12 S A -1.8186
13 K A -2.7736
14 D A -2.7672
15 S A -1.5807
16 A A -0.9399
17 A A -1.0011
18 G A -0.8469
19 A A -0.5392
20 A A -0.9252
21 S A -0.7061
22 T A -0.8846
23 P A -1.1733
24 D A -1.9690
25 E A 0.0000
26 K A -2.1873
27 I A -1.5223
28 V A 0.0000
29 L A -1.5940
30 E A -2.4361
31 F A 0.0000
32 M A 0.0000
33 D A -2.3247
34 A A -1.6188
35 L A 0.0000
36 T A -0.7619
37 S A -1.0554
38 N A -0.8052
39 D A -1.2356
40 A A -1.4647
41 A A -1.6035
42 K A -2.4512
43 L A 0.0000
44 I A 0.0000
45 E A -2.6123
46 Y A -1.2781
47 F A 0.0000
48 A A -2.3890
49 E A -3.2719
50 D A -2.6525
51 T A 0.0000
52 M A -0.4571
53 Y A 0.0000
54 Q A 0.0000
55 N A 0.0107
56 M A 0.0881
57 P A -0.5003
58 L A -0.1576
59 P A -0.3679
60 P A 0.0430
61 A A 0.0000
62 Y A 0.3707
63 G A -1.3303
64 R A -2.6402
65 D A -2.6655
66 A A -1.3250
67 V A 0.0000
68 E A -2.5303
69 Q A -2.0971
70 T A -1.0259
71 L A 0.0000
72 A A -0.6348
73 G A -0.3532
74 L A 0.1735
75 F A 0.3294
76 T A 0.4326
77 V A 0.8584
78 M A 0.2895
79 S A -0.0257
80 I A -0.1807
81 D A -0.6099
82 A A -0.7822
83 V A -0.4932
84 E A -1.3734
85 T A -0.7318
86 F A 0.0000
87 H A -0.4834
88 I A -0.0883
89 G A -0.0849
90 S A -0.4668
91 S A -0.8400
92 N A -1.5239
93 G A -1.4025
94 L A -0.3984
95 V A 0.0000
96 Y A 0.7042
97 T A 0.0000
98 E A -0.1381
99 R A 0.0000
100 V A -0.4913
101 D A 0.0000
102 V A 0.0000
103 L A 0.0000
104 R A -0.9255
105 A A 0.0000
106 L A 0.4933
107 P A -0.3093
108 T A -0.9580
109 G A -1.2690
110 K A -1.8668
111 S A -1.0807
112 Y A -0.9650
113 N A -0.8244
114 L A 0.0000
115 S A -0.3598
116 I A 0.0000
117 L A 0.9373
118 G A 0.0000
119 V A 0.3868
120 F A 0.0000
121 Q A -1.1806
122 L A 0.0000
123 T A -1.7785
124 E A -2.3589
125 G A -1.9379
126 K A -2.3889
127 I A 0.0000
128 T A -1.4022
129 G A 0.0000
130 W A 0.0000
131 R A -0.3159
132 D A 0.0000
133 Y A 0.5847
134 F A -0.5420
135 D A -2.5881
136 L A 0.0000
137 R A -3.9328
138 E A -3.7362
139 F A 0.0000
140 E A 0.0000
141 E A -3.4950
142 A A -2.3793
143 V A 0.0000
144 D A -2.6882
145 L A -1.5349
146 P A -1.6311
147 L A -1.0064
148 R A -2.0524
149 G A -1.2555
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018