Project name: query_structure

Status: done

Started: 2026-03-17 01:23:42
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGGWSGYQEFEVPGSKSTATISGLSPGVDYTITVYAYGYPYVKYNKSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:36)
Show buried residues

Minimal score value
-2.4138
Maximal score value
2.2354
Average score
-0.4152
Total score value
-38.6152

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7988
2 S A 0.5139
3 S A 0.0000
4 V A -0.1422
5 P A 0.0000
6 T A -1.3423
7 K A -2.3794
8 L A 0.0000
9 E A -1.7580
10 V A 0.1115
11 V A 1.5406
12 A A 0.8999
13 A A 0.3232
14 T A -0.1964
15 P A -0.8046
16 T A -0.5344
17 S A -0.3173
18 L A 0.0000
19 L A 0.7480
20 I A 0.0000
21 S A -0.7747
22 W A 0.0000
23 D A -1.7280
24 A A -0.7939
25 P A 0.2474
26 A A 0.5973
27 V A 0.7270
28 T A 0.1420
29 V A -0.0810
30 D A -0.5158
31 Y A -0.7158
32 Y A 0.0000
33 V A -0.7734
34 I A 0.0000
35 T A 0.0000
36 Y A -0.6110
37 G A 0.0000
38 E A -1.2091
39 T A -1.0084
40 G A -0.6264
41 G A -0.2298
42 W A 0.7799
43 S A -0.0465
44 G A -0.4348
45 Y A -0.2296
46 Q A -1.5011
47 E A -2.1408
48 F A -1.2146
49 E A -1.8090
50 V A 0.0000
51 P A -1.3389
52 G A -1.2648
53 S A -1.2572
54 K A -2.0190
55 S A -1.1665
56 T A -0.6278
57 A A 0.0000
58 T A 0.2396
59 I A 0.0000
60 S A -0.4763
61 G A -0.6866
62 L A 0.0000
63 S A -0.8594
64 P A -0.9971
65 G A -1.1005
66 V A -0.9686
67 D A -1.9147
68 Y A 0.0000
69 T A -0.8993
70 I A 0.0000
71 T A 0.0000
72 V A 0.0000
73 Y A -0.3717
74 A A 0.0000
75 Y A 0.5423
76 G A 0.0000
77 Y A 1.8115
78 P A 1.4055
79 Y A 2.2354
80 V A 2.0897
81 K A -0.1315
82 Y A -0.3983
83 N A -1.9964
84 K A -2.4138
85 S A -1.3284
86 P A -0.6491
87 I A -0.3538
88 S A -0.5384
89 I A -0.7106
90 N A -1.7602
91 Y A -1.5115
92 R A -2.3843
93 T A -1.3257
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018